Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8N786

Protein Details
Accession B8N786    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-44KVDKQEKPKTPKGRARKRIVYTRRFBasic
NLS Segment(s)
PositionSequence
10-37RAGKVKAATPKVDKQEKPKTPKGRARKR
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKAATPKVDKQEKPKTPKGRARKRIVYTRRFVNVTMTGGKRKMNANPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.33
4 0.33
5 0.37
6 0.43
7 0.48
8 0.55
9 0.54
10 0.56
11 0.62
12 0.65
13 0.68
14 0.7
15 0.71
16 0.72
17 0.78
18 0.79
19 0.8
20 0.81
21 0.82
22 0.82
23 0.8
24 0.81
25 0.81
26 0.79
27 0.73
28 0.7
29 0.66
30 0.58
31 0.52
32 0.47
33 0.4
34 0.35
35 0.37
36 0.33
37 0.33
38 0.33
39 0.35
40 0.33
41 0.34
42 0.39