Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2TCV8

Protein Details
Accession A0A3M2TCV8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-63LSSTRALSKKKDKSKPSPSNEPAEHydrophilic
NLS Segment(s)
PositionSequence
49-53KKDKS
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR002661  Ribosome_recyc_fac  
IPR023584  Ribosome_recyc_fac_dom  
IPR036191  RRF_sf  
Gene Ontology GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01765  RRF  
Amino Acid Sequences MPPISPFSSMLALRRGSQRILPRFNPAYTPQPWQHNTRFLSSTRALSKKKDKSKPSPSNEPAEQPAAAKGPKAAPTSEDPDDLSAMQTGIEVATGRLKDELSKLRAGGRVNTETIEMLRVQLKSGGGGGGGGKETVRVGELAQVVPRGGRMTTVLVSEEDHVKPITSAIMGSALSLTPQPDPHNSLQLNIPIPPPTKESRDQNVQAARQAWEKASGAIRDSRGAMHKHLQDLQKKKIALADDVRKAHDRMEKLVEKGQKEAKDLLEGAKKGLEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.31
4 0.36
5 0.43
6 0.47
7 0.54
8 0.53
9 0.55
10 0.57
11 0.56
12 0.54
13 0.49
14 0.47
15 0.42
16 0.47
17 0.43
18 0.48
19 0.51
20 0.53
21 0.55
22 0.56
23 0.55
24 0.53
25 0.51
26 0.43
27 0.46
28 0.41
29 0.42
30 0.41
31 0.46
32 0.44
33 0.5
34 0.59
35 0.62
36 0.7
37 0.73
38 0.75
39 0.78
40 0.86
41 0.88
42 0.86
43 0.87
44 0.81
45 0.79
46 0.72
47 0.65
48 0.57
49 0.49
50 0.41
51 0.3
52 0.27
53 0.23
54 0.2
55 0.17
56 0.16
57 0.17
58 0.22
59 0.23
60 0.22
61 0.21
62 0.26
63 0.31
64 0.3
65 0.28
66 0.22
67 0.21
68 0.22
69 0.19
70 0.15
71 0.1
72 0.08
73 0.07
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.07
81 0.07
82 0.08
83 0.09
84 0.09
85 0.1
86 0.15
87 0.21
88 0.2
89 0.22
90 0.22
91 0.25
92 0.28
93 0.27
94 0.26
95 0.25
96 0.24
97 0.23
98 0.23
99 0.2
100 0.17
101 0.16
102 0.14
103 0.09
104 0.08
105 0.1
106 0.1
107 0.09
108 0.11
109 0.11
110 0.09
111 0.1
112 0.09
113 0.05
114 0.06
115 0.06
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.07
127 0.08
128 0.08
129 0.09
130 0.09
131 0.09
132 0.08
133 0.09
134 0.06
135 0.05
136 0.05
137 0.06
138 0.07
139 0.08
140 0.09
141 0.09
142 0.09
143 0.09
144 0.1
145 0.12
146 0.1
147 0.11
148 0.1
149 0.1
150 0.09
151 0.09
152 0.09
153 0.06
154 0.05
155 0.05
156 0.06
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.06
163 0.06
164 0.06
165 0.08
166 0.1
167 0.12
168 0.18
169 0.19
170 0.26
171 0.25
172 0.26
173 0.26
174 0.28
175 0.27
176 0.23
177 0.22
178 0.18
179 0.2
180 0.2
181 0.22
182 0.22
183 0.26
184 0.31
185 0.37
186 0.41
187 0.48
188 0.49
189 0.51
190 0.54
191 0.5
192 0.48
193 0.43
194 0.38
195 0.32
196 0.31
197 0.25
198 0.22
199 0.21
200 0.2
201 0.22
202 0.22
203 0.21
204 0.24
205 0.24
206 0.22
207 0.22
208 0.22
209 0.24
210 0.25
211 0.27
212 0.31
213 0.33
214 0.35
215 0.41
216 0.45
217 0.49
218 0.54
219 0.57
220 0.56
221 0.53
222 0.5
223 0.48
224 0.43
225 0.41
226 0.43
227 0.44
228 0.45
229 0.47
230 0.49
231 0.49
232 0.47
233 0.46
234 0.43
235 0.37
236 0.35
237 0.43
238 0.44
239 0.44
240 0.5
241 0.5
242 0.45
243 0.49
244 0.51
245 0.45
246 0.44
247 0.45
248 0.4
249 0.39
250 0.39
251 0.39
252 0.4
253 0.36
254 0.34
255 0.34