Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2SW25

Protein Details
Accession A0A3M2SW25    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-59WGVWKVHKAKKNQKTRQGMWRKMWTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
Amino Acid Sequences MIEGEVSVQLLKAKSRAKPSTKTGKQGSSSCSWWGVWKVHKAKKNQKTRQGMWRKMWTLEEYRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.36
3 0.44
4 0.48
5 0.53
6 0.6
7 0.66
8 0.66
9 0.68
10 0.64
11 0.61
12 0.59
13 0.55
14 0.51
15 0.43
16 0.4
17 0.33
18 0.29
19 0.23
20 0.2
21 0.2
22 0.2
23 0.2
24 0.27
25 0.35
26 0.4
27 0.46
28 0.54
29 0.62
30 0.68
31 0.75
32 0.76
33 0.77
34 0.81
35 0.82
36 0.83
37 0.83
38 0.82
39 0.8
40 0.8
41 0.73
42 0.67
43 0.64
44 0.59