Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2TET4

Protein Details
Accession A0A3M2TET4   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-69TTPPRTRPIRSPRTPPRRGYHydrophilic
NLS Segment(s)
PositionSequence
35-68PGRGPGGPSRSIRRLTTPPRTRPIRSPRTPPRRG
227-233GKRKPKG
Subcellular Location(s) mito 14, extr 4, cyto 3, nucl 2, E.R. 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045866  FAM210A/B-like  
IPR009688  FAM210A/B-like_dom  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF06916  FAM210A-B_dom  
Amino Acid Sequences MSFRPALIPRLLKPQGAWLPRPSLPGPCPWRGLGPGRGPGGPSRSIRRLTTPPRTRPIRSPRTPPRRGYSTHPNKEEPKSDTKHASFSQRMRRLSREYGWSALGVYLLLSALDFPFCFAAVRLLGVDRIGHYEQVIMDSLRSVLPGGFGGLEEEGGSGSEGDGDGAGDESQIARANRRNSGAEASIWTQLALAYAIHKSFIFLRVPLTAAVTPKVVKVLRRWGWDIGKRKPKGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.45
4 0.47
5 0.41
6 0.45
7 0.45
8 0.5
9 0.42
10 0.4
11 0.37
12 0.43
13 0.45
14 0.43
15 0.44
16 0.4
17 0.41
18 0.39
19 0.43
20 0.41
21 0.4
22 0.42
23 0.41
24 0.4
25 0.38
26 0.37
27 0.35
28 0.33
29 0.32
30 0.33
31 0.37
32 0.4
33 0.41
34 0.43
35 0.49
36 0.52
37 0.59
38 0.62
39 0.64
40 0.69
41 0.74
42 0.71
43 0.72
44 0.74
45 0.73
46 0.7
47 0.73
48 0.75
49 0.79
50 0.83
51 0.79
52 0.76
53 0.7
54 0.67
55 0.64
56 0.64
57 0.65
58 0.66
59 0.64
60 0.62
61 0.62
62 0.64
63 0.61
64 0.55
65 0.52
66 0.48
67 0.48
68 0.49
69 0.45
70 0.46
71 0.43
72 0.45
73 0.42
74 0.45
75 0.51
76 0.51
77 0.54
78 0.52
79 0.55
80 0.53
81 0.52
82 0.49
83 0.45
84 0.39
85 0.37
86 0.34
87 0.29
88 0.23
89 0.18
90 0.14
91 0.08
92 0.06
93 0.04
94 0.03
95 0.03
96 0.02
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.05
115 0.08
116 0.08
117 0.08
118 0.08
119 0.09
120 0.09
121 0.09
122 0.1
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.05
130 0.04
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.03
145 0.03
146 0.04
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.04
153 0.04
154 0.03
155 0.04
156 0.04
157 0.05
158 0.09
159 0.09
160 0.13
161 0.19
162 0.23
163 0.27
164 0.3
165 0.32
166 0.3
167 0.34
168 0.31
169 0.27
170 0.26
171 0.24
172 0.23
173 0.2
174 0.18
175 0.14
176 0.12
177 0.11
178 0.09
179 0.07
180 0.07
181 0.09
182 0.09
183 0.1
184 0.1
185 0.1
186 0.12
187 0.16
188 0.16
189 0.15
190 0.17
191 0.17
192 0.19
193 0.18
194 0.19
195 0.17
196 0.17
197 0.18
198 0.18
199 0.18
200 0.17
201 0.23
202 0.22
203 0.24
204 0.29
205 0.39
206 0.43
207 0.49
208 0.52
209 0.53
210 0.61
211 0.65
212 0.68
213 0.68
214 0.71