Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2SMW2

Protein Details
Accession A0A3M2SMW2    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MRPTCCPNRPPRCGAKRCRRTPDLYRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008076  Cyanase  
IPR003712  Cyanate_lyase_C  
IPR036581  Cyanate_lyase_C_sf  
Gene Ontology GO:0008824  F:cyanate hydratase activity  
GO:0009439  P:cyanate metabolic process  
Pfam View protein in Pfam  
PF02560  Cyanate_lyase  
Amino Acid Sequences MRPTCCPNRPPRCGAKRCRRTPDLYRLDEIVGVYGRTIKALIEEKVGTGIMSAIDLEMSVTRETNPKGGRVKREMPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.87
5 0.88
6 0.83
7 0.8
8 0.79
9 0.79
10 0.77
11 0.69
12 0.62
13 0.54
14 0.48
15 0.41
16 0.31
17 0.22
18 0.13
19 0.09
20 0.07
21 0.08
22 0.07
23 0.06
24 0.07
25 0.05
26 0.08
27 0.1
28 0.11
29 0.12
30 0.12
31 0.12
32 0.12
33 0.12
34 0.09
35 0.07
36 0.06
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.06
46 0.06
47 0.07
48 0.08
49 0.13
50 0.15
51 0.22
52 0.23
53 0.28
54 0.37
55 0.44
56 0.51
57 0.55