Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2T933

Protein Details
Accession A0A3M2T933    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
64-87MAFDRGHKRKKATKKRGPKVLRTEBasic
NLS Segment(s)
PositionSequence
68-84RGHKRKKATKKRGPKVL
Subcellular Location(s) nucl 15, cyto_nucl 11.833, mito_nucl 10.333, cyto 7.5
Family & Domain DBs
Gene Ontology GO:0016740  F:transferase activity  
Amino Acid Sequences MSYHNYHTMFQSGQAVDRVRGSRLPAEGPQLSTLEEAFTSENWIIRLYKVKDLDNFGRDHSSAMAFDRGHKRKKATKKRGPKVLRTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.26
5 0.25
6 0.21
7 0.23
8 0.24
9 0.23
10 0.23
11 0.25
12 0.22
13 0.26
14 0.25
15 0.25
16 0.23
17 0.2
18 0.19
19 0.16
20 0.14
21 0.09
22 0.08
23 0.07
24 0.07
25 0.06
26 0.08
27 0.07
28 0.08
29 0.08
30 0.09
31 0.09
32 0.09
33 0.16
34 0.16
35 0.21
36 0.23
37 0.25
38 0.27
39 0.32
40 0.36
41 0.31
42 0.3
43 0.27
44 0.27
45 0.24
46 0.23
47 0.18
48 0.15
49 0.12
50 0.13
51 0.16
52 0.14
53 0.21
54 0.3
55 0.36
56 0.42
57 0.47
58 0.53
59 0.59
60 0.7
61 0.75
62 0.76
63 0.8
64 0.84
65 0.89
66 0.93
67 0.92