Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2T4F2

Protein Details
Accession A0A3M2T4F2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MANRLQYRRRNPYNTRSNKVRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MANRLQYRRRNPYNTRSNKVRIVKTPGGELRYLHLKKRGTAPKCGDCGIKLPGVPALRPREYAQISRPKKNVSRAYGGSRCAGCVKDRIVRAFLIEEQKIVKKVLKESQEKGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.8
4 0.76
5 0.76
6 0.76
7 0.72
8 0.67
9 0.67
10 0.64
11 0.58
12 0.59
13 0.54
14 0.48
15 0.42
16 0.36
17 0.3
18 0.35
19 0.35
20 0.31
21 0.33
22 0.33
23 0.34
24 0.44
25 0.49
26 0.42
27 0.5
28 0.54
29 0.53
30 0.54
31 0.53
32 0.44
33 0.35
34 0.35
35 0.28
36 0.22
37 0.16
38 0.14
39 0.16
40 0.16
41 0.15
42 0.18
43 0.21
44 0.2
45 0.22
46 0.23
47 0.26
48 0.27
49 0.29
50 0.31
51 0.36
52 0.4
53 0.44
54 0.46
55 0.45
56 0.48
57 0.55
58 0.56
59 0.51
60 0.53
61 0.5
62 0.56
63 0.54
64 0.51
65 0.45
66 0.37
67 0.33
68 0.28
69 0.26
70 0.19
71 0.2
72 0.22
73 0.25
74 0.28
75 0.3
76 0.3
77 0.29
78 0.29
79 0.27
80 0.27
81 0.28
82 0.24
83 0.23
84 0.24
85 0.28
86 0.28
87 0.27
88 0.27
89 0.24
90 0.31
91 0.38
92 0.44
93 0.47
94 0.49
95 0.58