Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2SUJ4

Protein Details
Accession A0A3M2SUJ4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
33-53EERWARAKRNRDQAREKRKKVBasic
NLS Segment(s)
PositionSequence
38-52RAKRNRDQAREKRKK
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MTALDECHARGFLYKALGNCNDIKRDVNKCLSEERWARAKRNRDQAREKRKKVEQLWADERAFERGFPPASSSGAESSNTGATNAAAPAGEGEKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.25
4 0.27
5 0.28
6 0.31
7 0.31
8 0.29
9 0.29
10 0.31
11 0.32
12 0.35
13 0.38
14 0.39
15 0.38
16 0.37
17 0.41
18 0.39
19 0.4
20 0.38
21 0.36
22 0.39
23 0.4
24 0.44
25 0.46
26 0.53
27 0.53
28 0.61
29 0.65
30 0.64
31 0.72
32 0.76
33 0.81
34 0.82
35 0.79
36 0.75
37 0.73
38 0.74
39 0.66
40 0.65
41 0.59
42 0.57
43 0.58
44 0.56
45 0.5
46 0.43
47 0.4
48 0.35
49 0.29
50 0.21
51 0.17
52 0.15
53 0.16
54 0.15
55 0.17
56 0.14
57 0.16
58 0.16
59 0.17
60 0.15
61 0.16
62 0.16
63 0.13
64 0.14
65 0.15
66 0.14
67 0.13
68 0.11
69 0.1
70 0.11
71 0.1
72 0.09
73 0.07
74 0.07
75 0.08