Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2STM6

Protein Details
Accession A0A3M2STM6   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
62-86AGWLKTEIGKPRKQRRTLKQMHADLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017894  HTH_IS21_transposase_type  
Pfam View protein in Pfam  
PF13412  HTH_24  
PROSITE View protein in PROSITE  
PS50531  HTH_IS21  
Amino Acid Sequences MGLLNIIRRMHLREKLSIREIARRTGLSRNTVSKHLAANTIEPKFAAPERASKLDPFSEKLAGWLKTEIGKPRKQRRTLKQMHADL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.54
4 0.53
5 0.48
6 0.49
7 0.48
8 0.43
9 0.4
10 0.35
11 0.34
12 0.36
13 0.37
14 0.34
15 0.35
16 0.36
17 0.36
18 0.37
19 0.36
20 0.31
21 0.29
22 0.25
23 0.25
24 0.2
25 0.21
26 0.23
27 0.22
28 0.2
29 0.18
30 0.17
31 0.15
32 0.15
33 0.15
34 0.1
35 0.15
36 0.19
37 0.23
38 0.24
39 0.23
40 0.25
41 0.26
42 0.27
43 0.24
44 0.23
45 0.22
46 0.2
47 0.24
48 0.27
49 0.24
50 0.23
51 0.21
52 0.2
53 0.22
54 0.26
55 0.32
56 0.34
57 0.4
58 0.49
59 0.59
60 0.68
61 0.74
62 0.81
63 0.82
64 0.86
65 0.89
66 0.9