Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2TA77

Protein Details
Accession A0A3M2TA77   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
22-44GQSHHHNKRLTNKRLTNKRGAAYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR024655  Asl1_glyco_hydro_catalytic  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF11790  Glyco_hydro_cc  
Amino Acid Sequences MVSFKLATAALLATSALAAPHGQSHHHNKRLTNKRLTNKRGAAYTVPSLVHPVSESVSWAYDWNMLPNGILPTGPEYVPMLWGSKMFGGWGTAIQTMLSSGSKYILGFNEPDMAHQANMSPSDAVSSYLNYITPYAGQATLISPAVSNGDGPSQGLNWLKTFMDSCGECNIGGLAVHWYGESAEDFKNFVSKAIDLGNQYGISEIWVTEFALNSALSGGDPSKSADFLQQAMPWLDSQPNVARYAYFMCETGHLLDSPNTLSITGQTYTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.09
8 0.1
9 0.13
10 0.2
11 0.31
12 0.41
13 0.48
14 0.52
15 0.55
16 0.64
17 0.73
18 0.75
19 0.75
20 0.74
21 0.77
22 0.84
23 0.85
24 0.84
25 0.8
26 0.75
27 0.67
28 0.61
29 0.54
30 0.48
31 0.43
32 0.36
33 0.3
34 0.26
35 0.26
36 0.22
37 0.19
38 0.15
39 0.13
40 0.11
41 0.11
42 0.12
43 0.1
44 0.11
45 0.11
46 0.11
47 0.11
48 0.14
49 0.14
50 0.15
51 0.15
52 0.14
53 0.13
54 0.15
55 0.15
56 0.11
57 0.1
58 0.08
59 0.1
60 0.12
61 0.12
62 0.11
63 0.11
64 0.11
65 0.12
66 0.12
67 0.11
68 0.09
69 0.1
70 0.1
71 0.09
72 0.09
73 0.08
74 0.07
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.07
82 0.07
83 0.06
84 0.07
85 0.07
86 0.05
87 0.05
88 0.06
89 0.07
90 0.07
91 0.08
92 0.08
93 0.09
94 0.09
95 0.1
96 0.14
97 0.13
98 0.13
99 0.14
100 0.14
101 0.13
102 0.12
103 0.13
104 0.09
105 0.1
106 0.1
107 0.07
108 0.06
109 0.07
110 0.07
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.08
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.05
131 0.05
132 0.06
133 0.06
134 0.05
135 0.05
136 0.05
137 0.05
138 0.06
139 0.06
140 0.05
141 0.08
142 0.09
143 0.1
144 0.09
145 0.11
146 0.11
147 0.11
148 0.12
149 0.1
150 0.12
151 0.11
152 0.12
153 0.13
154 0.14
155 0.13
156 0.12
157 0.11
158 0.08
159 0.07
160 0.06
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.06
168 0.06
169 0.07
170 0.08
171 0.09
172 0.09
173 0.09
174 0.12
175 0.12
176 0.12
177 0.12
178 0.11
179 0.12
180 0.14
181 0.17
182 0.14
183 0.16
184 0.16
185 0.14
186 0.14
187 0.13
188 0.1
189 0.09
190 0.08
191 0.07
192 0.06
193 0.06
194 0.07
195 0.07
196 0.07
197 0.07
198 0.08
199 0.08
200 0.07
201 0.07
202 0.06
203 0.06
204 0.07
205 0.07
206 0.06
207 0.07
208 0.09
209 0.1
210 0.11
211 0.12
212 0.14
213 0.15
214 0.17
215 0.19
216 0.18
217 0.2
218 0.2
219 0.21
220 0.17
221 0.18
222 0.18
223 0.15
224 0.18
225 0.21
226 0.23
227 0.24
228 0.23
229 0.22
230 0.22
231 0.25
232 0.24
233 0.19
234 0.18
235 0.16
236 0.18
237 0.2
238 0.2
239 0.18
240 0.16
241 0.17
242 0.18
243 0.18
244 0.18
245 0.18
246 0.16
247 0.14
248 0.14
249 0.14
250 0.16