Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2TBF8

Protein Details
Accession A0A3M2TBF8   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-112GKIVRVRSREGRRNRAPPPRIRFNKDGKKITPBasic
NLS Segment(s)
PositionSequence
85-110RVRSREGRRNRAPPPRIRFNKDGKKI
Subcellular Location(s) mito 14, cyto 8, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRANNGRNKSGRGHVRPVRCSNCARCVPKDKAIKRFTIRNMVESAAIRDISDASVFADYAVPKMYLKLHYCVSCAIHGKIVRVRSREGRRNRAPPPRIRFNKDGKKITPPQAGKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.67
3 0.69
4 0.65
5 0.66
6 0.7
7 0.74
8 0.71
9 0.65
10 0.66
11 0.62
12 0.63
13 0.63
14 0.6
15 0.58
16 0.61
17 0.62
18 0.63
19 0.68
20 0.65
21 0.66
22 0.65
23 0.66
24 0.61
25 0.63
26 0.59
27 0.59
28 0.53
29 0.46
30 0.44
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.05
49 0.06
50 0.07
51 0.06
52 0.06
53 0.07
54 0.09
55 0.13
56 0.15
57 0.17
58 0.2
59 0.2
60 0.21
61 0.22
62 0.21
63 0.2
64 0.21
65 0.19
66 0.21
67 0.21
68 0.23
69 0.25
70 0.31
71 0.32
72 0.32
73 0.35
74 0.4
75 0.49
76 0.56
77 0.62
78 0.66
79 0.7
80 0.76
81 0.8
82 0.81
83 0.8
84 0.81
85 0.8
86 0.81
87 0.8
88 0.79
89 0.78
90 0.79
91 0.81
92 0.81
93 0.8
94 0.73
95 0.74
96 0.75
97 0.76
98 0.75
99 0.68