Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SVU3

Protein Details
Accession A0A3M2SVU3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
93-117IAKIERKLKKEWTKKYKDARAGTNPHydrophilic
NLS Segment(s)
PositionSequence
99-102KLKK
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, mito 8
Family & Domain DBs
Amino Acid Sequences MSLPVVPASNGKFSFAVDSSVDSFYVESSGNHLHPPRDHPRNSRSISSRTPRPLKATKISCTTGIPAPKQKAVANMRLFDAVQSGSLTVPGEIAKIERKLKKEWTKKYKDARAGTNPAGDGAAATAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.22
4 0.16
5 0.18
6 0.18
7 0.18
8 0.18
9 0.14
10 0.13
11 0.11
12 0.11
13 0.09
14 0.07
15 0.1
16 0.13
17 0.13
18 0.17
19 0.18
20 0.2
21 0.22
22 0.29
23 0.35
24 0.41
25 0.46
26 0.49
27 0.54
28 0.6
29 0.61
30 0.6
31 0.56
32 0.53
33 0.56
34 0.55
35 0.56
36 0.55
37 0.57
38 0.53
39 0.55
40 0.55
41 0.53
42 0.55
43 0.53
44 0.48
45 0.48
46 0.47
47 0.41
48 0.35
49 0.32
50 0.26
51 0.24
52 0.23
53 0.23
54 0.24
55 0.24
56 0.25
57 0.24
58 0.29
59 0.3
60 0.36
61 0.34
62 0.33
63 0.32
64 0.31
65 0.3
66 0.21
67 0.19
68 0.1
69 0.08
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.05
76 0.06
77 0.05
78 0.06
79 0.05
80 0.07
81 0.11
82 0.16
83 0.23
84 0.27
85 0.31
86 0.36
87 0.47
88 0.56
89 0.62
90 0.68
91 0.72
92 0.77
93 0.83
94 0.88
95 0.87
96 0.86
97 0.82
98 0.8
99 0.78
100 0.76
101 0.69
102 0.62
103 0.53
104 0.44
105 0.37
106 0.28
107 0.19