Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2T755

Protein Details
Accession A0A3M2T755   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-106AAPQPTRSRRHPQPRCKWVKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, cyto_nucl 8.833, cyto_mito 8.833, nucl 6.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009784  DUF1349  
Pfam View protein in Pfam  
PF07081  DUF1349  
Amino Acid Sequences MPPHGSSFTALNLPPTFTLPQCMEYFTLTAGPNTDLWRKPPNGDTSTAPMVFTSLRHPFIVAEVTVSADWEMEWDQGGLVIFAGAAPQPTRSRRHPQPRCKWVKAGMEFSSGTVNATSVSATADGADWCLSPLCVPAHSLRIKLERIGYSLWIWYQVPSSLSGPATPTPGAVRGSWRKLREVTWFFYGVEDKFTHVGVYASRPTNLSRSNTMWELRNATTLPSSAASGDGLEVEFEDLEIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.2
5 0.25
6 0.22
7 0.25
8 0.24
9 0.25
10 0.23
11 0.22
12 0.22
13 0.17
14 0.2
15 0.16
16 0.16
17 0.15
18 0.16
19 0.16
20 0.19
21 0.25
22 0.22
23 0.27
24 0.34
25 0.35
26 0.37
27 0.42
28 0.46
29 0.43
30 0.44
31 0.43
32 0.41
33 0.43
34 0.4
35 0.33
36 0.25
37 0.23
38 0.2
39 0.18
40 0.17
41 0.17
42 0.19
43 0.19
44 0.2
45 0.19
46 0.2
47 0.21
48 0.15
49 0.11
50 0.09
51 0.11
52 0.1
53 0.1
54 0.08
55 0.06
56 0.06
57 0.06
58 0.07
59 0.05
60 0.06
61 0.06
62 0.05
63 0.06
64 0.06
65 0.05
66 0.04
67 0.04
68 0.03
69 0.03
70 0.04
71 0.03
72 0.04
73 0.04
74 0.07
75 0.11
76 0.15
77 0.2
78 0.26
79 0.35
80 0.45
81 0.56
82 0.64
83 0.71
84 0.78
85 0.84
86 0.87
87 0.82
88 0.76
89 0.72
90 0.7
91 0.63
92 0.57
93 0.47
94 0.41
95 0.37
96 0.34
97 0.27
98 0.19
99 0.15
100 0.09
101 0.08
102 0.05
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.04
115 0.04
116 0.05
117 0.04
118 0.04
119 0.06
120 0.06
121 0.06
122 0.08
123 0.09
124 0.16
125 0.17
126 0.18
127 0.19
128 0.22
129 0.23
130 0.23
131 0.25
132 0.2
133 0.2
134 0.2
135 0.19
136 0.15
137 0.15
138 0.13
139 0.12
140 0.11
141 0.1
142 0.1
143 0.09
144 0.1
145 0.11
146 0.12
147 0.12
148 0.12
149 0.12
150 0.13
151 0.13
152 0.15
153 0.13
154 0.12
155 0.11
156 0.14
157 0.15
158 0.13
159 0.2
160 0.25
161 0.32
162 0.38
163 0.39
164 0.41
165 0.41
166 0.44
167 0.46
168 0.44
169 0.41
170 0.39
171 0.38
172 0.34
173 0.34
174 0.33
175 0.23
176 0.23
177 0.19
178 0.17
179 0.16
180 0.16
181 0.14
182 0.12
183 0.13
184 0.1
185 0.15
186 0.19
187 0.19
188 0.2
189 0.21
190 0.23
191 0.28
192 0.33
193 0.32
194 0.32
195 0.33
196 0.37
197 0.4
198 0.41
199 0.39
200 0.37
201 0.38
202 0.33
203 0.34
204 0.29
205 0.27
206 0.26
207 0.22
208 0.21
209 0.17
210 0.16
211 0.13
212 0.14
213 0.12
214 0.1
215 0.1
216 0.09
217 0.08
218 0.07
219 0.07
220 0.07
221 0.07