Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NBW0

Protein Details
Accession B8NBW0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRRTYCKGKECKKHTQHKVTQYKAGKHydrophilic
73-93ECTACKQKKQLSLKRCKHFELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKGKECKKHTQHKVTQYKAGKASLYAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTACKQKKQLSLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.88
5 0.87
6 0.88
7 0.87
8 0.87
9 0.86
10 0.86
11 0.88
12 0.81
13 0.8
14 0.74
15 0.69
16 0.62
17 0.55
18 0.44
19 0.35
20 0.34
21 0.33
22 0.34
23 0.32
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.52
30 0.56
31 0.61
32 0.61
33 0.61
34 0.61
35 0.61
36 0.59
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.5
63 0.46
64 0.43
65 0.45
66 0.47
67 0.51
68 0.6
69 0.64
70 0.65
71 0.74
72 0.79
73 0.83
74 0.81
75 0.75
76 0.7
77 0.63
78 0.6
79 0.6
80 0.59
81 0.57
82 0.57
83 0.54
84 0.5
85 0.48
86 0.42