Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2T274

Protein Details
Accession A0A3M2T274    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAQVKQKKKWSKGKVKDKADHAVHydrophilic
NLS Segment(s)
PositionSequence
7-16KKKWSKGKVK
Subcellular Location(s) nucl 14.5, mito_nucl 10, cyto 8, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAQVKQKKKWSKGKVKDKADHAVVFEKQTSERLQKDVQNFRLITVATLVDRFKINGSLARKALSELEENGQIKKVVGHHNMNIYTRAVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.88
4 0.83
5 0.79
6 0.73
7 0.63
8 0.54
9 0.49
10 0.4
11 0.35
12 0.29
13 0.23
14 0.19
15 0.2
16 0.21
17 0.21
18 0.22
19 0.24
20 0.27
21 0.3
22 0.38
23 0.43
24 0.42
25 0.42
26 0.4
27 0.37
28 0.35
29 0.31
30 0.23
31 0.16
32 0.13
33 0.08
34 0.09
35 0.08
36 0.07
37 0.08
38 0.08
39 0.08
40 0.09
41 0.1
42 0.14
43 0.17
44 0.21
45 0.21
46 0.22
47 0.22
48 0.21
49 0.22
50 0.19
51 0.17
52 0.15
53 0.16
54 0.21
55 0.21
56 0.21
57 0.21
58 0.19
59 0.17
60 0.18
61 0.21
62 0.25
63 0.31
64 0.35
65 0.38
66 0.44
67 0.48
68 0.47
69 0.44
70 0.37