Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2SV56

Protein Details
Accession A0A3M2SV56    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
83-106KALKEPPRDRKKEKNIKHNKSIPLBasic
NLS Segment(s)
PositionSequence
86-100KEPPRDRKKEKNIKH
Subcellular Location(s) cyto 18.5, cyto_nucl 14.333, nucl 7, mito_nucl 4.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR000911  Ribosomal_L11/L12  
IPR036796  Ribosomal_L11/L12_N_sf  
IPR020783  Ribosomal_L11_C  
IPR036769  Ribosomal_L11_C_sf  
IPR020784  Ribosomal_L11_N  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00298  Ribosomal_L11  
PF03946  Ribosomal_L11_N  
CDD cd00349  Ribosomal_L11  
Amino Acid Sequences MPPKFDPNEVKIVHLRVTGGEIGAQSALAPKVGPLGLSPKKIGEDIAKNTGDWKGLRVTVKLTIQNRQAEVSVVPSASSLVIKALKEPPRDRKKEKNIKHNKSIPLDDIIDIARTMRFRSFAKELRGTVCEILGTAFSVGCQIDGRSPKDVSDDVKAGEIDIPEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.21
4 0.24
5 0.2
6 0.15
7 0.14
8 0.11
9 0.11
10 0.1
11 0.09
12 0.06
13 0.08
14 0.08
15 0.07
16 0.07
17 0.06
18 0.09
19 0.09
20 0.09
21 0.08
22 0.17
23 0.21
24 0.23
25 0.24
26 0.23
27 0.24
28 0.24
29 0.25
30 0.23
31 0.25
32 0.27
33 0.33
34 0.32
35 0.3
36 0.31
37 0.31
38 0.27
39 0.2
40 0.18
41 0.14
42 0.17
43 0.19
44 0.18
45 0.19
46 0.21
47 0.24
48 0.28
49 0.27
50 0.29
51 0.33
52 0.35
53 0.34
54 0.3
55 0.27
56 0.22
57 0.2
58 0.17
59 0.12
60 0.09
61 0.09
62 0.08
63 0.08
64 0.07
65 0.07
66 0.04
67 0.05
68 0.07
69 0.07
70 0.09
71 0.15
72 0.2
73 0.26
74 0.31
75 0.4
76 0.48
77 0.56
78 0.61
79 0.65
80 0.71
81 0.76
82 0.8
83 0.8
84 0.81
85 0.82
86 0.85
87 0.82
88 0.77
89 0.72
90 0.66
91 0.56
92 0.48
93 0.42
94 0.32
95 0.26
96 0.19
97 0.14
98 0.12
99 0.11
100 0.09
101 0.08
102 0.09
103 0.1
104 0.13
105 0.13
106 0.19
107 0.26
108 0.31
109 0.37
110 0.4
111 0.41
112 0.42
113 0.42
114 0.38
115 0.31
116 0.25
117 0.18
118 0.14
119 0.12
120 0.09
121 0.08
122 0.06
123 0.06
124 0.05
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.13
131 0.19
132 0.22
133 0.26
134 0.26
135 0.26
136 0.3
137 0.32
138 0.29
139 0.3
140 0.29
141 0.26
142 0.28
143 0.27
144 0.23
145 0.23