Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2TCN2

Protein Details
Accession A0A3M2TCN2    Localization Confidence High Confidence Score 19.7
NoLS Segment(s)
PositionSequenceProtein Nature
78-99AAETPTKKTPNKRKANGKAGGGHydrophilic
122-141ETSTPKRQRKTPTKKGTAVKHydrophilic
165-190EDTPVSTPTKPKRKSNPKSKTAMKGAHydrophilic
NLS Segment(s)
PositionSequence
88-92NKRKA
127-147KRQRKTPTKKGTAVKVTKKKG
174-184KPKRKSNPKSK
Subcellular Location(s) cyto 15, nucl 7, mito 4
Family & Domain DBs
Amino Acid Sequences MSTPTKPKADAMLGLSHTDAKILIWGIFCITDQGKIDYDKLAEKAGYKNGASASVTYRNARKNFLSVNAGDADVTGTAAETPTKKTPNKRKANGKAGGGADAEGDEGTESAAAANGGAEGGETSTPKRQRKTPTKKGTAVKVTKKKGQAKDADNEGEGDGENEGEDTPVSTPTKPKRKSNPKSKTAMKGATAVKQEGDEDEELALTTKTNLSAGMELPGDSSVEREIEDMDDGTNAEGSSVAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.26
4 0.22
5 0.19
6 0.15
7 0.09
8 0.1
9 0.11
10 0.11
11 0.1
12 0.11
13 0.11
14 0.12
15 0.11
16 0.12
17 0.12
18 0.13
19 0.14
20 0.17
21 0.18
22 0.19
23 0.21
24 0.19
25 0.2
26 0.2
27 0.2
28 0.19
29 0.18
30 0.19
31 0.22
32 0.25
33 0.27
34 0.24
35 0.25
36 0.23
37 0.25
38 0.23
39 0.2
40 0.2
41 0.23
42 0.25
43 0.26
44 0.3
45 0.36
46 0.37
47 0.4
48 0.37
49 0.35
50 0.36
51 0.37
52 0.36
53 0.28
54 0.29
55 0.26
56 0.24
57 0.19
58 0.16
59 0.12
60 0.08
61 0.07
62 0.05
63 0.04
64 0.04
65 0.04
66 0.06
67 0.06
68 0.1
69 0.15
70 0.21
71 0.26
72 0.36
73 0.47
74 0.56
75 0.66
76 0.71
77 0.77
78 0.81
79 0.86
80 0.81
81 0.72
82 0.66
83 0.56
84 0.49
85 0.38
86 0.28
87 0.18
88 0.13
89 0.11
90 0.05
91 0.05
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.02
98 0.03
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.03
109 0.03
110 0.05
111 0.1
112 0.17
113 0.22
114 0.24
115 0.31
116 0.41
117 0.52
118 0.62
119 0.68
120 0.71
121 0.75
122 0.8
123 0.78
124 0.76
125 0.74
126 0.71
127 0.7
128 0.68
129 0.65
130 0.63
131 0.67
132 0.68
133 0.65
134 0.65
135 0.63
136 0.59
137 0.6
138 0.59
139 0.51
140 0.43
141 0.37
142 0.29
143 0.22
144 0.17
145 0.12
146 0.07
147 0.05
148 0.05
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.05
155 0.08
156 0.09
157 0.1
158 0.18
159 0.27
160 0.38
161 0.43
162 0.52
163 0.6
164 0.7
165 0.8
166 0.84
167 0.85
168 0.83
169 0.86
170 0.85
171 0.82
172 0.79
173 0.73
174 0.63
175 0.59
176 0.54
177 0.51
178 0.46
179 0.38
180 0.3
181 0.26
182 0.25
183 0.19
184 0.2
185 0.14
186 0.12
187 0.11
188 0.11
189 0.1
190 0.11
191 0.1
192 0.06
193 0.07
194 0.07
195 0.08
196 0.08
197 0.08
198 0.09
199 0.11
200 0.11
201 0.12
202 0.12
203 0.11
204 0.12
205 0.12
206 0.11
207 0.09
208 0.1
209 0.08
210 0.08
211 0.09
212 0.09
213 0.09
214 0.1
215 0.11
216 0.11
217 0.1
218 0.1
219 0.1
220 0.1
221 0.1
222 0.08
223 0.07
224 0.07
225 0.07