Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SS54

Protein Details
Accession A0A3M2SS54    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-78IAPRWRPRRFHVFSDRHRQDBasic
NLS Segment(s)
Subcellular Location(s) mito 7cyto 7pero 7cyto_mito 7cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004291  Transposase_IS66_central  
Pfam View protein in Pfam  
PF03050  DDE_Tnp_IS66  
Amino Acid Sequences MSKHNPVAKAINYMFEEDGRWEAFTRFLDDGRICLSNNAAERALRGIALGPQGLALRRIAPRWRPRRFHVFSDRHRQDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.25
3 0.24
4 0.17
5 0.19
6 0.14
7 0.13
8 0.12
9 0.12
10 0.14
11 0.14
12 0.17
13 0.15
14 0.15
15 0.18
16 0.17
17 0.17
18 0.16
19 0.17
20 0.13
21 0.12
22 0.13
23 0.12
24 0.12
25 0.13
26 0.11
27 0.1
28 0.1
29 0.11
30 0.11
31 0.08
32 0.07
33 0.06
34 0.07
35 0.08
36 0.07
37 0.06
38 0.07
39 0.08
40 0.08
41 0.09
42 0.08
43 0.1
44 0.12
45 0.16
46 0.22
47 0.31
48 0.41
49 0.51
50 0.6
51 0.63
52 0.69
53 0.76
54 0.75
55 0.76
56 0.76
57 0.76
58 0.75
59 0.8