Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2SVL2

Protein Details
Accession A0A3M2SVL2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-21TANKHKTRPAGKRLGAKRTNHydrophilic
NLS Segment(s)
PositionSequence
8-15TRPAGKRL
Subcellular Location(s) mito 14, cyto 8, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences GTANKHKTRPAGKRLGAKRTNGEYVVPGCILFKQRGTTWYPGENCEFGRDHSIFAMQPGYVRYYRDPSMHPDRKYIGIALDKDGVLPRPLNAPTRRRLSKALAPRLPDRVATVPVSVTAGEPSAGAARASGVGAADGPQLRPGYMWREANWQIGRAAETRGEGAAVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.77
4 0.72
5 0.69
6 0.65
7 0.63
8 0.54
9 0.47
10 0.4
11 0.35
12 0.32
13 0.25
14 0.19
15 0.15
16 0.16
17 0.18
18 0.16
19 0.17
20 0.18
21 0.19
22 0.23
23 0.27
24 0.3
25 0.3
26 0.35
27 0.35
28 0.34
29 0.35
30 0.33
31 0.29
32 0.28
33 0.25
34 0.19
35 0.24
36 0.21
37 0.19
38 0.18
39 0.19
40 0.15
41 0.15
42 0.15
43 0.08
44 0.09
45 0.09
46 0.12
47 0.12
48 0.14
49 0.15
50 0.18
51 0.2
52 0.22
53 0.22
54 0.26
55 0.36
56 0.42
57 0.41
58 0.39
59 0.39
60 0.39
61 0.38
62 0.31
63 0.23
64 0.2
65 0.19
66 0.18
67 0.17
68 0.15
69 0.14
70 0.14
71 0.12
72 0.09
73 0.09
74 0.08
75 0.1
76 0.11
77 0.18
78 0.23
79 0.27
80 0.32
81 0.4
82 0.42
83 0.42
84 0.44
85 0.43
86 0.45
87 0.5
88 0.54
89 0.49
90 0.5
91 0.5
92 0.5
93 0.46
94 0.39
95 0.32
96 0.25
97 0.24
98 0.21
99 0.19
100 0.15
101 0.14
102 0.14
103 0.11
104 0.09
105 0.07
106 0.07
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.05
119 0.04
120 0.05
121 0.06
122 0.08
123 0.08
124 0.08
125 0.12
126 0.12
127 0.12
128 0.13
129 0.15
130 0.18
131 0.24
132 0.27
133 0.25
134 0.33
135 0.35
136 0.43
137 0.42
138 0.38
139 0.32
140 0.31
141 0.31
142 0.25
143 0.25
144 0.18
145 0.18
146 0.17
147 0.16