Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SWS4

Protein Details
Accession A0A3M2SWS4   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
343-363SPEERKRQEEMPRNPKKRMFEBasic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, cyto_nucl 9, nucl 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005606  Sec20  
Gene Ontology GO:0016020  C:membrane  
GO:0005484  F:SNAP receptor activity  
GO:0006890  P:retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum  
Pfam View protein in Pfam  
PF03908  Sec20  
Amino Acid Sequences MSAPTLQSRLKELSAALGQIHPLIDRLRDFTASVGQGDQARLELGAEVHARLKEAEEEMELLRDEADGLGTGAENRRKGLDSEKEAEKERVVSLAEKLAMDLKRARGDFRNAQLQAKKNAEVAKRKERELLLSRNQPDNQKRPAEKLTQGDVEMNAAGDVTAALRRTHQTMQAELSRSQFAQQTLEQSTAAVSSLSESYTSVDTLLASSRNLLGSLLRSQKSDTWYLETAFYIIVGTIIWLLFRRIFYGPLWWLVWLPVRLVARFTLAVFGAVGITNKSVQPAASPTGSTAAQETAIPTLSRETATYGTEAPTPGEQESDRMIDRIGKMADDGEEETNVQDISPEERKRQEEMPRNPKKRMFEAEVNKDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.22
4 0.19
5 0.18
6 0.18
7 0.18
8 0.12
9 0.12
10 0.13
11 0.15
12 0.16
13 0.19
14 0.2
15 0.21
16 0.21
17 0.21
18 0.25
19 0.23
20 0.22
21 0.19
22 0.19
23 0.2
24 0.2
25 0.19
26 0.13
27 0.12
28 0.11
29 0.11
30 0.09
31 0.07
32 0.1
33 0.11
34 0.11
35 0.14
36 0.15
37 0.15
38 0.14
39 0.16
40 0.15
41 0.16
42 0.16
43 0.14
44 0.16
45 0.15
46 0.16
47 0.15
48 0.12
49 0.1
50 0.09
51 0.09
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.07
59 0.12
60 0.16
61 0.16
62 0.17
63 0.19
64 0.2
65 0.22
66 0.29
67 0.33
68 0.35
69 0.4
70 0.44
71 0.45
72 0.47
73 0.47
74 0.39
75 0.32
76 0.26
77 0.22
78 0.18
79 0.17
80 0.15
81 0.17
82 0.17
83 0.14
84 0.14
85 0.18
86 0.17
87 0.19
88 0.21
89 0.21
90 0.26
91 0.26
92 0.3
93 0.29
94 0.36
95 0.39
96 0.41
97 0.46
98 0.42
99 0.48
100 0.5
101 0.5
102 0.5
103 0.46
104 0.42
105 0.36
106 0.41
107 0.42
108 0.45
109 0.48
110 0.52
111 0.52
112 0.52
113 0.54
114 0.49
115 0.5
116 0.48
117 0.49
118 0.46
119 0.51
120 0.53
121 0.53
122 0.54
123 0.55
124 0.55
125 0.54
126 0.53
127 0.53
128 0.51
129 0.51
130 0.54
131 0.51
132 0.48
133 0.45
134 0.42
135 0.36
136 0.34
137 0.3
138 0.25
139 0.2
140 0.15
141 0.11
142 0.07
143 0.05
144 0.04
145 0.03
146 0.03
147 0.03
148 0.04
149 0.05
150 0.06
151 0.07
152 0.08
153 0.12
154 0.13
155 0.18
156 0.18
157 0.19
158 0.22
159 0.24
160 0.26
161 0.24
162 0.24
163 0.2
164 0.19
165 0.18
166 0.18
167 0.15
168 0.14
169 0.14
170 0.16
171 0.16
172 0.16
173 0.15
174 0.12
175 0.12
176 0.09
177 0.09
178 0.05
179 0.04
180 0.04
181 0.05
182 0.05
183 0.05
184 0.05
185 0.06
186 0.06
187 0.07
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.06
194 0.06
195 0.06
196 0.07
197 0.07
198 0.07
199 0.06
200 0.06
201 0.08
202 0.13
203 0.18
204 0.18
205 0.19
206 0.2
207 0.23
208 0.26
209 0.28
210 0.24
211 0.23
212 0.23
213 0.24
214 0.23
215 0.2
216 0.17
217 0.13
218 0.12
219 0.07
220 0.05
221 0.04
222 0.03
223 0.03
224 0.03
225 0.03
226 0.04
227 0.04
228 0.05
229 0.07
230 0.07
231 0.1
232 0.1
233 0.12
234 0.12
235 0.17
236 0.17
237 0.18
238 0.18
239 0.16
240 0.15
241 0.15
242 0.19
243 0.14
244 0.13
245 0.15
246 0.16
247 0.16
248 0.17
249 0.16
250 0.14
251 0.15
252 0.14
253 0.12
254 0.1
255 0.1
256 0.09
257 0.09
258 0.07
259 0.07
260 0.07
261 0.06
262 0.06
263 0.07
264 0.08
265 0.09
266 0.09
267 0.08
268 0.1
269 0.13
270 0.15
271 0.15
272 0.15
273 0.14
274 0.17
275 0.17
276 0.15
277 0.13
278 0.11
279 0.1
280 0.1
281 0.1
282 0.09
283 0.1
284 0.1
285 0.09
286 0.11
287 0.12
288 0.12
289 0.12
290 0.14
291 0.14
292 0.15
293 0.16
294 0.15
295 0.15
296 0.16
297 0.17
298 0.15
299 0.15
300 0.15
301 0.14
302 0.16
303 0.15
304 0.15
305 0.17
306 0.19
307 0.18
308 0.17
309 0.17
310 0.2
311 0.2
312 0.24
313 0.22
314 0.19
315 0.18
316 0.19
317 0.19
318 0.17
319 0.18
320 0.14
321 0.14
322 0.14
323 0.14
324 0.14
325 0.13
326 0.1
327 0.09
328 0.09
329 0.14
330 0.23
331 0.26
332 0.31
333 0.39
334 0.42
335 0.45
336 0.52
337 0.56
338 0.58
339 0.65
340 0.71
341 0.75
342 0.78
343 0.82
344 0.82
345 0.78
346 0.76
347 0.74
348 0.72
349 0.71
350 0.75
351 0.77