Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2TGZ4

Protein Details
Accession A0A3M2TGZ4   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-39LLWKTPWRISQPQKARQRKRLRSVDSVVHydrophilic
74-100KYTIFDKKERKYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
80-94KKERKYRKGIHKLPK
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPLLGGLLWKTPWRISQPQKARQRKRLRSVDSVVDTLSTALQRNGHNAKAVDRWYAEMPREQEMVPKDKYTIFDKKERKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.22
5 0.27
6 0.35
7 0.41
8 0.5
9 0.59
10 0.66
11 0.75
12 0.82
13 0.84
14 0.85
15 0.88
16 0.88
17 0.88
18 0.89
19 0.84
20 0.81
21 0.75
22 0.72
23 0.63
24 0.54
25 0.43
26 0.33
27 0.27
28 0.19
29 0.16
30 0.09
31 0.07
32 0.07
33 0.11
34 0.11
35 0.16
36 0.18
37 0.18
38 0.2
39 0.2
40 0.21
41 0.21
42 0.22
43 0.18
44 0.16
45 0.17
46 0.16
47 0.18
48 0.17
49 0.17
50 0.18
51 0.19
52 0.2
53 0.18
54 0.2
55 0.22
56 0.26
57 0.24
58 0.23
59 0.21
60 0.22
61 0.25
62 0.27
63 0.33
64 0.32
65 0.4
66 0.48
67 0.55
68 0.63
69 0.7
70 0.69
71 0.71
72 0.76
73 0.78
74 0.81
75 0.83
76 0.83
77 0.84
78 0.89
79 0.88
80 0.88
81 0.83
82 0.8
83 0.8
84 0.8
85 0.8
86 0.77
87 0.79