Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2TCI9

Protein Details
Accession A0A3M2TCI9    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
353-381RDRAVWKKLYDDFRRRRKHVCRLLSYPAPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 4, nucl 3, golg 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
Amino Acid Sequences MAGRKSPSYAPRRGSTSSERDFFDIPDEPILAVAKRQLRHIRTWVVFGLFVLFIFWLQHKPAKPPLPHIRYDLVDWSRYAYTQYATSSPYLCNSIMIFEALHRLGSRAERVLFYPYDWDLEVDDSSDRDSQLLVMARDKYNVQTVPIDIQMIKGGSGSTESWDTSISKFLAFGETHYERVIHLDSDSTVLQNMDELFFLPSAQVAMPRAFWELPHTKQLSSQLIVLEPSHREYYALMEEAKPAMYGQVDTSDNDTHQYDMDILDKRYGNSALVLPHRQYNLITGEFRNKDHRRYLGNEYETWDPDRALAEAKFIHFSDWPLPKPWVMWPRELLTEVMPKCDYKPGTAEESGCRDRAVWKKLYDDFRRRRKHVCRLLSYPAPDWPPHENPQGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.61
4 0.59
5 0.57
6 0.53
7 0.5
8 0.48
9 0.42
10 0.38
11 0.31
12 0.25
13 0.23
14 0.22
15 0.19
16 0.19
17 0.2
18 0.15
19 0.13
20 0.17
21 0.22
22 0.22
23 0.31
24 0.39
25 0.42
26 0.49
27 0.55
28 0.59
29 0.55
30 0.57
31 0.51
32 0.44
33 0.39
34 0.32
35 0.27
36 0.17
37 0.15
38 0.12
39 0.09
40 0.08
41 0.09
42 0.1
43 0.1
44 0.13
45 0.19
46 0.21
47 0.26
48 0.35
49 0.43
50 0.44
51 0.52
52 0.6
53 0.61
54 0.62
55 0.61
56 0.56
57 0.49
58 0.48
59 0.47
60 0.38
61 0.34
62 0.31
63 0.3
64 0.25
65 0.24
66 0.24
67 0.17
68 0.15
69 0.16
70 0.18
71 0.16
72 0.17
73 0.19
74 0.18
75 0.17
76 0.18
77 0.19
78 0.17
79 0.16
80 0.14
81 0.14
82 0.13
83 0.12
84 0.11
85 0.08
86 0.12
87 0.1
88 0.11
89 0.1
90 0.1
91 0.12
92 0.14
93 0.16
94 0.16
95 0.17
96 0.18
97 0.19
98 0.22
99 0.2
100 0.18
101 0.19
102 0.16
103 0.16
104 0.16
105 0.15
106 0.11
107 0.12
108 0.12
109 0.1
110 0.09
111 0.08
112 0.1
113 0.1
114 0.09
115 0.08
116 0.08
117 0.08
118 0.11
119 0.13
120 0.12
121 0.14
122 0.17
123 0.18
124 0.19
125 0.19
126 0.17
127 0.19
128 0.19
129 0.17
130 0.15
131 0.16
132 0.16
133 0.16
134 0.16
135 0.11
136 0.11
137 0.11
138 0.09
139 0.09
140 0.07
141 0.06
142 0.05
143 0.07
144 0.07
145 0.07
146 0.08
147 0.08
148 0.08
149 0.09
150 0.1
151 0.09
152 0.12
153 0.11
154 0.09
155 0.1
156 0.1
157 0.12
158 0.11
159 0.11
160 0.15
161 0.16
162 0.17
163 0.17
164 0.17
165 0.13
166 0.15
167 0.15
168 0.08
169 0.08
170 0.07
171 0.07
172 0.09
173 0.09
174 0.07
175 0.07
176 0.06
177 0.06
178 0.06
179 0.06
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.06
186 0.05
187 0.04
188 0.05
189 0.05
190 0.05
191 0.06
192 0.06
193 0.06
194 0.07
195 0.09
196 0.09
197 0.09
198 0.14
199 0.17
200 0.19
201 0.25
202 0.25
203 0.24
204 0.26
205 0.31
206 0.28
207 0.24
208 0.24
209 0.18
210 0.17
211 0.18
212 0.16
213 0.13
214 0.11
215 0.12
216 0.12
217 0.11
218 0.11
219 0.11
220 0.13
221 0.13
222 0.14
223 0.12
224 0.11
225 0.12
226 0.12
227 0.12
228 0.09
229 0.07
230 0.07
231 0.06
232 0.06
233 0.06
234 0.09
235 0.1
236 0.1
237 0.13
238 0.13
239 0.13
240 0.15
241 0.15
242 0.11
243 0.11
244 0.11
245 0.08
246 0.08
247 0.12
248 0.14
249 0.14
250 0.17
251 0.18
252 0.18
253 0.2
254 0.2
255 0.16
256 0.15
257 0.16
258 0.16
259 0.19
260 0.22
261 0.2
262 0.23
263 0.24
264 0.23
265 0.21
266 0.21
267 0.21
268 0.21
269 0.22
270 0.2
271 0.28
272 0.29
273 0.31
274 0.38
275 0.38
276 0.41
277 0.45
278 0.48
279 0.45
280 0.49
281 0.55
282 0.54
283 0.54
284 0.49
285 0.46
286 0.45
287 0.41
288 0.38
289 0.3
290 0.21
291 0.19
292 0.18
293 0.16
294 0.16
295 0.14
296 0.14
297 0.15
298 0.16
299 0.18
300 0.17
301 0.18
302 0.16
303 0.18
304 0.23
305 0.28
306 0.29
307 0.29
308 0.31
309 0.3
310 0.31
311 0.37
312 0.38
313 0.35
314 0.38
315 0.38
316 0.4
317 0.42
318 0.41
319 0.34
320 0.28
321 0.34
322 0.29
323 0.29
324 0.27
325 0.26
326 0.26
327 0.33
328 0.3
329 0.25
330 0.29
331 0.29
332 0.34
333 0.36
334 0.37
335 0.34
336 0.41
337 0.41
338 0.37
339 0.33
340 0.27
341 0.33
342 0.39
343 0.42
344 0.41
345 0.41
346 0.48
347 0.55
348 0.64
349 0.67
350 0.69
351 0.72
352 0.76
353 0.83
354 0.82
355 0.85
356 0.85
357 0.86
358 0.85
359 0.85
360 0.83
361 0.79
362 0.83
363 0.8
364 0.73
365 0.65
366 0.6
367 0.54
368 0.46
369 0.44
370 0.43
371 0.42
372 0.44