Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2T8D3

Protein Details
Accession A0A3M2T8D3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VLAKKHVPIVKKRTKRFWRHQSDRFKCVPHydrophilic
NLS Segment(s)
PositionSequence
12-17KKRTKR
Subcellular Location(s) mito 19.5, mito_nucl 11.833, cyto 4.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVLAKKHVPIVKKRTKRFWRHQSDRFKCVPSAWRKPKGIDNAVRRRFKSVIPMPNIGYGSNKKTRHMMPSGHKAFVVHNPRDVELLLMHNRTYAAEIAHAVSSRKRVDILSKAKALGVKVTNPKGRVTNEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.88
4 0.89
5 0.89
6 0.9
7 0.9
8 0.91
9 0.91
10 0.88
11 0.84
12 0.78
13 0.7
14 0.6
15 0.54
16 0.54
17 0.52
18 0.56
19 0.58
20 0.62
21 0.61
22 0.63
23 0.66
24 0.66
25 0.65
26 0.62
27 0.63
28 0.65
29 0.71
30 0.74
31 0.67
32 0.63
33 0.56
34 0.48
35 0.48
36 0.45
37 0.45
38 0.44
39 0.46
40 0.41
41 0.42
42 0.42
43 0.32
44 0.27
45 0.21
46 0.22
47 0.27
48 0.27
49 0.25
50 0.29
51 0.31
52 0.33
53 0.34
54 0.36
55 0.34
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.32
62 0.34
63 0.35
64 0.26
65 0.27
66 0.28
67 0.28
68 0.29
69 0.27
70 0.19
71 0.13
72 0.16
73 0.14
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.13
80 0.1
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.17
90 0.18
91 0.18
92 0.18
93 0.19
94 0.25
95 0.34
96 0.4
97 0.41
98 0.42
99 0.42
100 0.42
101 0.43
102 0.37
103 0.34
104 0.29
105 0.3
106 0.36
107 0.44
108 0.48
109 0.48
110 0.51
111 0.5