Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SX27

Protein Details
Accession A0A3M2SX27   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-21PIPEAAPSRRRKRPAPGPVSHydrophilic
29-52AVSYGRRKAKPVKKKASVPRDHEQHydrophilic
NLS Segment(s)
PositionSequence
9-18SRRRKRPAPG
33-44GRRKAKPVKKKA
Subcellular Location(s) nucl 13, cyto_nucl 9.5, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
CDD cd15505  PHD_ING  
Amino Acid Sequences TPIPEAAPSRRRKRPAPGPVSSGQDGGAAVSYGRRKAKPVKKKASVPRDHEQESSLPPNHGFRIDEDGVREEIDANEPRYCVCGDVSFGTMICCENPDCDREWFHLNCVGLSEVPSRTAKWYCPDCRVKFHKGVDGIVRVGSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.79
4 0.75
5 0.72
6 0.7
7 0.69
8 0.59
9 0.49
10 0.38
11 0.29
12 0.23
13 0.17
14 0.13
15 0.07
16 0.06
17 0.09
18 0.11
19 0.15
20 0.2
21 0.21
22 0.26
23 0.36
24 0.47
25 0.54
26 0.63
27 0.68
28 0.72
29 0.81
30 0.86
31 0.86
32 0.85
33 0.81
34 0.79
35 0.75
36 0.69
37 0.6
38 0.51
39 0.42
40 0.37
41 0.36
42 0.28
43 0.22
44 0.21
45 0.22
46 0.21
47 0.2
48 0.17
49 0.12
50 0.19
51 0.19
52 0.19
53 0.18
54 0.18
55 0.17
56 0.17
57 0.15
58 0.08
59 0.08
60 0.11
61 0.11
62 0.11
63 0.12
64 0.12
65 0.12
66 0.13
67 0.12
68 0.1
69 0.09
70 0.08
71 0.08
72 0.1
73 0.11
74 0.09
75 0.09
76 0.09
77 0.08
78 0.08
79 0.07
80 0.07
81 0.06
82 0.08
83 0.09
84 0.11
85 0.13
86 0.15
87 0.17
88 0.19
89 0.25
90 0.23
91 0.24
92 0.27
93 0.24
94 0.22
95 0.21
96 0.19
97 0.13
98 0.15
99 0.16
100 0.12
101 0.15
102 0.16
103 0.16
104 0.19
105 0.21
106 0.23
107 0.28
108 0.37
109 0.39
110 0.48
111 0.57
112 0.56
113 0.64
114 0.68
115 0.68
116 0.67
117 0.66
118 0.64
119 0.57
120 0.58
121 0.54
122 0.5
123 0.44
124 0.38