Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2T9C3

Protein Details
Accession A0A3M2T9C3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGQRHNRRRTRVRSRNRNVRFEPPAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
Amino Acid Sequences MGQRHNRRRTRVRSRNRNVRFEPPASPASSCDLAVPIIPKPTGGLGQWTGREFAACASCEPIPKYPAPTWHVGYVGWQQREHRLQLEAERFRLFGGEPGDDVSLCYRMLEYFDGLDYIDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.92
4 0.91
5 0.85
6 0.83
7 0.79
8 0.7
9 0.63
10 0.57
11 0.52
12 0.43
13 0.39
14 0.31
15 0.28
16 0.26
17 0.22
18 0.18
19 0.15
20 0.13
21 0.14
22 0.14
23 0.1
24 0.11
25 0.11
26 0.1
27 0.1
28 0.11
29 0.11
30 0.1
31 0.12
32 0.12
33 0.14
34 0.16
35 0.16
36 0.16
37 0.14
38 0.14
39 0.11
40 0.1
41 0.11
42 0.09
43 0.09
44 0.1
45 0.11
46 0.12
47 0.14
48 0.14
49 0.14
50 0.14
51 0.19
52 0.18
53 0.24
54 0.25
55 0.28
56 0.27
57 0.26
58 0.26
59 0.22
60 0.23
61 0.24
62 0.27
63 0.25
64 0.25
65 0.25
66 0.31
67 0.35
68 0.34
69 0.29
70 0.25
71 0.25
72 0.31
73 0.39
74 0.34
75 0.33
76 0.32
77 0.3
78 0.28
79 0.27
80 0.2
81 0.15
82 0.16
83 0.14
84 0.13
85 0.15
86 0.15
87 0.14
88 0.15
89 0.13
90 0.11
91 0.1
92 0.1
93 0.09
94 0.09
95 0.12
96 0.13
97 0.12
98 0.12
99 0.12
100 0.12