Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SUS8

Protein Details
Accession A0A3M2SUS8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-58QRPEGKETRKKRNTAKNKIIQARAHydrophilic
96-133KEQVKAEKKARNKEQAKKEKARAKEKARSQKKNKKYPHBasic
NLS Segment(s)
PositionSequence
38-133EGKETRKKRNTAKNKIIQARAKLDQTAKAGKKLGSKEKARTKEQAKKEKARAKEEARAKEQVKAEKKARNKEQAKKEKARAKEKARSQKKNKKYPH
Subcellular Location(s) cyto 9cyto_nucl 9, nucl 5, mito 3, extr 3, E.R. 3, pero 2
Family & Domain DBs
Amino Acid Sequences MLDTFALLILVTLLYVLGNGVLCHNGAKQWCRSEQRPEGKETRKKRNTAKNKIIQARAKLDQTAKAGKKLGSKEKARTKEQAKKEKARAKEEARAKEQVKAEKKARNKEQAKKEKARAKEKARSQKKNKKYPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.05
8 0.06
9 0.06
10 0.07
11 0.08
12 0.1
13 0.14
14 0.18
15 0.23
16 0.27
17 0.34
18 0.4
19 0.44
20 0.51
21 0.57
22 0.63
23 0.6
24 0.61
25 0.63
26 0.66
27 0.71
28 0.7
29 0.71
30 0.69
31 0.73
32 0.76
33 0.78
34 0.8
35 0.81
36 0.83
37 0.8
38 0.81
39 0.81
40 0.79
41 0.72
42 0.65
43 0.6
44 0.52
45 0.45
46 0.38
47 0.33
48 0.29
49 0.27
50 0.31
51 0.27
52 0.26
53 0.27
54 0.27
55 0.3
56 0.32
57 0.38
58 0.38
59 0.41
60 0.48
61 0.55
62 0.59
63 0.58
64 0.6
65 0.61
66 0.62
67 0.67
68 0.69
69 0.68
70 0.71
71 0.77
72 0.76
73 0.74
74 0.72
75 0.7
76 0.66
77 0.66
78 0.65
79 0.63
80 0.6
81 0.61
82 0.55
83 0.53
84 0.52
85 0.53
86 0.52
87 0.52
88 0.54
89 0.55
90 0.62
91 0.66
92 0.7
93 0.72
94 0.75
95 0.77
96 0.81
97 0.85
98 0.86
99 0.85
100 0.86
101 0.82
102 0.82
103 0.83
104 0.82
105 0.81
106 0.8
107 0.81
108 0.83
109 0.87
110 0.89
111 0.9
112 0.91
113 0.92