Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2T4Z9

Protein Details
Accession A0A3M2T4Z9   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
316-335DDAERQKRDHLRRTKAAEVRBasic
NLS Segment(s)
Subcellular Location(s) cyto 9, cyto_nucl 7.5, mito 7, extr 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013749  PM/HMP-P_kinase-1  
IPR004625  PyrdxlKinase  
IPR029056  Ribokinase-like  
Gene Ontology GO:0008478  F:pyridoxal kinase activity  
GO:0016310  P:phosphorylation  
GO:0009443  P:pyridoxal 5'-phosphate salvage  
Pfam View protein in Pfam  
PF08543  Phos_pyr_kin  
CDD cd01173  pyridoxal_pyridoxamine_kinase  
Amino Acid Sequences MSLVPETTVLAIASHVVYGYVGNTMAAFVMQSLGCDVAALNTVHFSNHTGYRQFKGSRASAQDIDDLYQGLALNRLTDFDVMLSGYAPSAAAVEAVGAIGLDLQRQAASKPGSFFWVLDPVMGDQGRLYVNPDVVPAYKNIIRHADLILPNQFEAEVLSGITITSIPTLADAITAIHRTYSLPHVIITSVQLSRLSHPPSSTPAPNDLTVIGSTTRSDGSARLFRVDVPALDCFFSGTGDMFAALMVARLREAVFDVPGLKDAPSWVSTDDVAPTDLPLAKAAVKVLASMHSVLEKTLEARAAELSVQPDEPPGLDDAERQKRDHLRRTKAAEVRLVRNVQFLQHPVVEFKVQGVEQGRSAAGASIDST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.06
6 0.07
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.05
15 0.04
16 0.07
17 0.06
18 0.07
19 0.07
20 0.08
21 0.08
22 0.08
23 0.08
24 0.06
25 0.1
26 0.1
27 0.09
28 0.1
29 0.11
30 0.11
31 0.12
32 0.13
33 0.14
34 0.19
35 0.23
36 0.27
37 0.3
38 0.33
39 0.39
40 0.39
41 0.39
42 0.41
43 0.4
44 0.42
45 0.45
46 0.47
47 0.42
48 0.42
49 0.41
50 0.35
51 0.33
52 0.26
53 0.21
54 0.15
55 0.14
56 0.12
57 0.09
58 0.1
59 0.09
60 0.1
61 0.09
62 0.1
63 0.1
64 0.1
65 0.1
66 0.08
67 0.08
68 0.07
69 0.07
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.03
80 0.04
81 0.03
82 0.03
83 0.03
84 0.02
85 0.02
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.05
92 0.06
93 0.06
94 0.11
95 0.14
96 0.15
97 0.17
98 0.18
99 0.2
100 0.2
101 0.2
102 0.16
103 0.19
104 0.17
105 0.15
106 0.16
107 0.13
108 0.16
109 0.15
110 0.13
111 0.08
112 0.1
113 0.1
114 0.09
115 0.11
116 0.09
117 0.1
118 0.1
119 0.11
120 0.11
121 0.11
122 0.12
123 0.1
124 0.12
125 0.14
126 0.14
127 0.16
128 0.19
129 0.19
130 0.2
131 0.2
132 0.22
133 0.21
134 0.23
135 0.23
136 0.2
137 0.19
138 0.17
139 0.16
140 0.1
141 0.09
142 0.07
143 0.05
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.06
162 0.06
163 0.05
164 0.06
165 0.06
166 0.07
167 0.1
168 0.1
169 0.1
170 0.1
171 0.1
172 0.1
173 0.1
174 0.1
175 0.09
176 0.08
177 0.08
178 0.09
179 0.09
180 0.11
181 0.16
182 0.18
183 0.17
184 0.17
185 0.18
186 0.21
187 0.25
188 0.24
189 0.21
190 0.22
191 0.23
192 0.23
193 0.22
194 0.18
195 0.15
196 0.13
197 0.13
198 0.09
199 0.07
200 0.07
201 0.08
202 0.07
203 0.07
204 0.08
205 0.08
206 0.12
207 0.16
208 0.17
209 0.18
210 0.18
211 0.17
212 0.2
213 0.2
214 0.16
215 0.13
216 0.14
217 0.13
218 0.13
219 0.13
220 0.1
221 0.09
222 0.09
223 0.07
224 0.06
225 0.05
226 0.05
227 0.05
228 0.05
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.05
237 0.05
238 0.05
239 0.07
240 0.07
241 0.07
242 0.08
243 0.09
244 0.09
245 0.1
246 0.1
247 0.09
248 0.08
249 0.09
250 0.1
251 0.1
252 0.11
253 0.11
254 0.11
255 0.12
256 0.12
257 0.13
258 0.11
259 0.11
260 0.1
261 0.09
262 0.1
263 0.11
264 0.11
265 0.1
266 0.11
267 0.11
268 0.11
269 0.12
270 0.11
271 0.1
272 0.1
273 0.1
274 0.11
275 0.12
276 0.12
277 0.12
278 0.12
279 0.12
280 0.11
281 0.12
282 0.1
283 0.1
284 0.11
285 0.13
286 0.11
287 0.12
288 0.13
289 0.12
290 0.13
291 0.13
292 0.13
293 0.12
294 0.13
295 0.12
296 0.13
297 0.12
298 0.12
299 0.11
300 0.1
301 0.11
302 0.11
303 0.15
304 0.24
305 0.34
306 0.36
307 0.36
308 0.42
309 0.5
310 0.59
311 0.65
312 0.66
313 0.65
314 0.72
315 0.78
316 0.8
317 0.77
318 0.73
319 0.71
320 0.67
321 0.64
322 0.62
323 0.59
324 0.5
325 0.49
326 0.44
327 0.38
328 0.36
329 0.33
330 0.3
331 0.29
332 0.3
333 0.27
334 0.29
335 0.27
336 0.23
337 0.21
338 0.21
339 0.18
340 0.22
341 0.24
342 0.23
343 0.22
344 0.24
345 0.23
346 0.18
347 0.19
348 0.16
349 0.12