Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2TBP1

Protein Details
Accession A0A3M2TBP1    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-64LPRLQPPRPEMPKKVKQRQAPGASKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 10, cyto_mito 8.5, mito 5
Family & Domain DBs
Pfam View protein in Pfam  
PF12754  Blt1  
PF17183  Blt1_C  
Amino Acid Sequences MAELAFVKSFLSVVDSRAIKIPADHVFDPERVGLRVPYTLPRLQPPRPEMPKKVKQRQAPGASKSITIRLKSARNPALEFTVPNTPLASTSVEDLKDAVRARVADSEGNKVALEKIKILYKRKPVTGKSIAEVLADEPDMMAGGKEVEFGVMVMGGAKVVEPTKEGEDQEWEKVPSQPAAEGERVLENDDFWDDLQTYLGRRLQDGGQAKKLRELFRNAWISSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.25
5 0.26
6 0.21
7 0.22
8 0.25
9 0.24
10 0.29
11 0.29
12 0.28
13 0.3
14 0.3
15 0.31
16 0.28
17 0.24
18 0.19
19 0.2
20 0.17
21 0.16
22 0.17
23 0.18
24 0.2
25 0.24
26 0.27
27 0.27
28 0.34
29 0.4
30 0.42
31 0.49
32 0.5
33 0.55
34 0.61
35 0.66
36 0.67
37 0.7
38 0.75
39 0.78
40 0.82
41 0.79
42 0.77
43 0.8
44 0.81
45 0.81
46 0.79
47 0.72
48 0.67
49 0.6
50 0.55
51 0.46
52 0.43
53 0.37
54 0.3
55 0.3
56 0.29
57 0.34
58 0.36
59 0.44
60 0.42
61 0.41
62 0.41
63 0.39
64 0.38
65 0.33
66 0.29
67 0.23
68 0.23
69 0.2
70 0.19
71 0.18
72 0.14
73 0.14
74 0.15
75 0.14
76 0.08
77 0.09
78 0.11
79 0.11
80 0.11
81 0.11
82 0.1
83 0.12
84 0.12
85 0.11
86 0.1
87 0.1
88 0.11
89 0.13
90 0.14
91 0.13
92 0.14
93 0.17
94 0.16
95 0.16
96 0.15
97 0.13
98 0.13
99 0.13
100 0.12
101 0.1
102 0.11
103 0.15
104 0.19
105 0.24
106 0.29
107 0.36
108 0.39
109 0.43
110 0.48
111 0.46
112 0.51
113 0.54
114 0.49
115 0.41
116 0.4
117 0.34
118 0.28
119 0.26
120 0.17
121 0.1
122 0.09
123 0.07
124 0.05
125 0.04
126 0.04
127 0.04
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.05
148 0.06
149 0.08
150 0.11
151 0.14
152 0.15
153 0.15
154 0.2
155 0.22
156 0.25
157 0.25
158 0.24
159 0.23
160 0.25
161 0.26
162 0.22
163 0.21
164 0.2
165 0.2
166 0.23
167 0.22
168 0.19
169 0.19
170 0.19
171 0.18
172 0.19
173 0.16
174 0.12
175 0.13
176 0.13
177 0.13
178 0.1
179 0.12
180 0.1
181 0.1
182 0.12
183 0.11
184 0.12
185 0.17
186 0.19
187 0.18
188 0.18
189 0.21
190 0.21
191 0.28
192 0.35
193 0.36
194 0.43
195 0.47
196 0.47
197 0.52
198 0.56
199 0.54
200 0.52
201 0.54
202 0.49
203 0.54
204 0.6