Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2T512

Protein Details
Accession A0A3M2T512    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-23AKSKNSSQHHWNQKNHRNGIKKHydrophilic
NLS Segment(s)
PositionSequence
17-62HRNGIKKPKTHRYPSLKGVDPKFRRNHRHALHGTMNAMKEKKQGKR
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHHWNQKNHRNGIKKPKTHRYPSLKGVDPKFRRNHRHALHGTMNAMKEKKQGKREVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.83
4 0.81
5 0.77
6 0.77
7 0.79
8 0.78
9 0.77
10 0.76
11 0.78
12 0.79
13 0.78
14 0.79
15 0.77
16 0.73
17 0.73
18 0.71
19 0.65
20 0.61
21 0.59
22 0.59
23 0.54
24 0.56
25 0.57
26 0.59
27 0.62
28 0.63
29 0.69
30 0.63
31 0.68
32 0.63
33 0.62
34 0.59
35 0.53
36 0.49
37 0.42
38 0.4
39 0.35
40 0.34
41 0.28
42 0.29
43 0.35
44 0.42
45 0.48