Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2T4A8

Protein Details
Accession A0A3M2T4A8    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-34IPTSADPRSRRPAKRRAVSPRSEHATHydrophilic
115-150RSRKETRRKDEEKTEKNRRRRDKKRAAKKGNNAGGGBasic
NLS Segment(s)
PositionSequence
16-24RSRRPAKRR
115-149RSRKETRRKDEEKTEKNRRRRDKKRAAKKGNNAGG
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPGRDSIPTSADPRSRRPAKRRAVSPRSEHATQVESLFRDPNKELKLSGPSQAKTASLMPPPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRLMQDEVDREKGEDEWQRSRKETRRKDEEKTEKNRRRRDKKRAAKKGNNAGGGGKGEDGMVVDSEGPGKKAPGEGADGGHAGAAVGPDQSAEMPGVVIHED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.5
4 0.56
5 0.63
6 0.69
7 0.73
8 0.77
9 0.83
10 0.85
11 0.86
12 0.86
13 0.84
14 0.82
15 0.8
16 0.77
17 0.68
18 0.6
19 0.51
20 0.44
21 0.37
22 0.32
23 0.26
24 0.2
25 0.2
26 0.23
27 0.21
28 0.22
29 0.23
30 0.28
31 0.27
32 0.27
33 0.27
34 0.26
35 0.32
36 0.3
37 0.35
38 0.34
39 0.31
40 0.32
41 0.32
42 0.29
43 0.25
44 0.25
45 0.22
46 0.19
47 0.21
48 0.21
49 0.21
50 0.22
51 0.2
52 0.18
53 0.15
54 0.14
55 0.16
56 0.15
57 0.14
58 0.13
59 0.12
60 0.12
61 0.11
62 0.09
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.07
72 0.07
73 0.12
74 0.19
75 0.26
76 0.31
77 0.35
78 0.41
79 0.49
80 0.56
81 0.61
82 0.61
83 0.58
84 0.54
85 0.51
86 0.46
87 0.39
88 0.33
89 0.27
90 0.21
91 0.2
92 0.18
93 0.17
94 0.16
95 0.14
96 0.17
97 0.18
98 0.2
99 0.27
100 0.32
101 0.34
102 0.36
103 0.43
104 0.47
105 0.53
106 0.59
107 0.6
108 0.66
109 0.69
110 0.73
111 0.77
112 0.79
113 0.78
114 0.78
115 0.8
116 0.78
117 0.83
118 0.86
119 0.86
120 0.87
121 0.88
122 0.89
123 0.89
124 0.91
125 0.93
126 0.94
127 0.94
128 0.93
129 0.92
130 0.91
131 0.87
132 0.78
133 0.67
134 0.57
135 0.48
136 0.39
137 0.3
138 0.19
139 0.12
140 0.1
141 0.09
142 0.08
143 0.06
144 0.06
145 0.05
146 0.05
147 0.05
148 0.08
149 0.09
150 0.1
151 0.1
152 0.1
153 0.11
154 0.13
155 0.14
156 0.13
157 0.17
158 0.17
159 0.18
160 0.19
161 0.18
162 0.16
163 0.14
164 0.12
165 0.07
166 0.07
167 0.06
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06