Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SZ66

Protein Details
Accession A0A3M2SZ66    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-51NPAMAQRKLDKQKSLKKSKAEALSRRNEKLARRNPDRIQRQIHydrophilic
NLS Segment(s)
PositionSequence
16-43RKLDKQKSLKKSKAEALSRRNEKLARRN
102-104RRG
112-116GKRRR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019007  WW_dom-bd_prot_11  
Gene Ontology GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF09429  Wbp11  
Amino Acid Sequences MPKDKERTLNPAMAQRKLDKQKSLKKSKAEALSRRNEKLARRNPDRIQRQIGELKSMEESGQSLRPREKQILEALERDLRAVQKAREELGDKAPRFEGGGARRGGGGDNVLGKRRRDEHNRGRFHGDKDESGDETDEEVRRIPMPRDTPPPIPREYQRKTRADDESRGPHALPSKPPAVEAKAVYESAPDIRNLRQEAVSKFVPAAVRAKQESIKGQGKLLEPEEMDQLEKAGYTAGPSTEKAPDTSQSAGDVDAEEQRLLEEEKRFNQELKRAHVEDVEDEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.53
4 0.57
5 0.61
6 0.61
7 0.66
8 0.72
9 0.78
10 0.84
11 0.81
12 0.8
13 0.8
14 0.79
15 0.79
16 0.78
17 0.77
18 0.76
19 0.79
20 0.77
21 0.73
22 0.7
23 0.65
24 0.64
25 0.65
26 0.65
27 0.65
28 0.66
29 0.72
30 0.74
31 0.8
32 0.8
33 0.77
34 0.75
35 0.66
36 0.65
37 0.63
38 0.56
39 0.51
40 0.43
41 0.37
42 0.3
43 0.28
44 0.22
45 0.15
46 0.15
47 0.13
48 0.18
49 0.18
50 0.2
51 0.25
52 0.3
53 0.35
54 0.39
55 0.38
56 0.36
57 0.4
58 0.44
59 0.41
60 0.38
61 0.36
62 0.33
63 0.31
64 0.28
65 0.23
66 0.17
67 0.19
68 0.21
69 0.2
70 0.22
71 0.24
72 0.24
73 0.25
74 0.26
75 0.25
76 0.31
77 0.37
78 0.32
79 0.32
80 0.32
81 0.29
82 0.27
83 0.26
84 0.22
85 0.18
86 0.24
87 0.22
88 0.22
89 0.22
90 0.22
91 0.21
92 0.15
93 0.12
94 0.07
95 0.11
96 0.12
97 0.17
98 0.2
99 0.2
100 0.23
101 0.27
102 0.33
103 0.38
104 0.48
105 0.54
106 0.61
107 0.66
108 0.65
109 0.67
110 0.64
111 0.58
112 0.55
113 0.46
114 0.37
115 0.35
116 0.33
117 0.27
118 0.24
119 0.21
120 0.13
121 0.13
122 0.14
123 0.11
124 0.09
125 0.09
126 0.09
127 0.1
128 0.12
129 0.12
130 0.15
131 0.18
132 0.21
133 0.27
134 0.31
135 0.36
136 0.39
137 0.41
138 0.39
139 0.38
140 0.4
141 0.43
142 0.44
143 0.47
144 0.52
145 0.53
146 0.54
147 0.57
148 0.6
149 0.55
150 0.55
151 0.51
152 0.48
153 0.46
154 0.43
155 0.37
156 0.3
157 0.3
158 0.29
159 0.26
160 0.24
161 0.25
162 0.24
163 0.25
164 0.26
165 0.24
166 0.23
167 0.21
168 0.21
169 0.19
170 0.19
171 0.18
172 0.15
173 0.14
174 0.13
175 0.13
176 0.11
177 0.11
178 0.13
179 0.18
180 0.19
181 0.2
182 0.21
183 0.25
184 0.25
185 0.29
186 0.27
187 0.23
188 0.22
189 0.22
190 0.2
191 0.17
192 0.19
193 0.18
194 0.22
195 0.22
196 0.25
197 0.25
198 0.28
199 0.3
200 0.34
201 0.37
202 0.33
203 0.33
204 0.36
205 0.35
206 0.36
207 0.33
208 0.28
209 0.22
210 0.23
211 0.24
212 0.19
213 0.18
214 0.14
215 0.13
216 0.1
217 0.09
218 0.08
219 0.06
220 0.06
221 0.06
222 0.08
223 0.09
224 0.11
225 0.12
226 0.15
227 0.18
228 0.19
229 0.2
230 0.21
231 0.22
232 0.24
233 0.25
234 0.23
235 0.21
236 0.2
237 0.18
238 0.16
239 0.15
240 0.12
241 0.14
242 0.14
243 0.12
244 0.12
245 0.11
246 0.13
247 0.14
248 0.18
249 0.21
250 0.25
251 0.31
252 0.38
253 0.4
254 0.43
255 0.47
256 0.5
257 0.51
258 0.54
259 0.57
260 0.52
261 0.52
262 0.5
263 0.46
264 0.42