Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2TEY2

Protein Details
Accession A0A3M2TEY2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
10-29EHSKHGKRPAPPKQKQAAKSBasic
NLS Segment(s)
PositionSequence
13-24KHGKRPAPPKQK
Subcellular Location(s) plas 13, mito 8, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MANEKYAKTEHSKHGKRPAPPKQKQAAKSPVSTGWVVVLAFIICGGLAFELLRVVPELWSFVTSMFKGLTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.72
4 0.76
5 0.77
6 0.77
7 0.78
8 0.79
9 0.79
10 0.8
11 0.77
12 0.75
13 0.74
14 0.66
15 0.6
16 0.53
17 0.45
18 0.39
19 0.35
20 0.25
21 0.16
22 0.13
23 0.11
24 0.08
25 0.07
26 0.04
27 0.04
28 0.04
29 0.03
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.05
41 0.06
42 0.06
43 0.07
44 0.08
45 0.09
46 0.1
47 0.1
48 0.09
49 0.13
50 0.13
51 0.15