Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SZV4

Protein Details
Accession A0A3M2SZV4    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKRQPRKLKWTKTHRAARGKEMIBasic
122-145SKVHGEGEKQKQKKKTRLLVDGGEBasic
NLS Segment(s)
PositionSequence
6-9RKLK
64-89RRERVFTKRRLAGKLARDRKKEEDRK
130-136KQKQKKK
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000988  Ribosomal_L24e-rel  
Amino Acid Sequences MKRQPRKLKWTKTHRAARGKEMIVDSSLVLSQFAKKRHAPVKYDRNLVASTVQAMDRVEQIRQRRERVFTKRRLAGKLARDRKKEEDRKVVADGEHLIRKELRQREEEGKPLATAEPGKVMSKVHGEGEKQKQKKKTRLLVDGGEQEEMDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.83
4 0.81
5 0.79
6 0.69
7 0.63
8 0.55
9 0.47
10 0.37
11 0.33
12 0.24
13 0.16
14 0.15
15 0.11
16 0.09
17 0.08
18 0.14
19 0.18
20 0.21
21 0.25
22 0.27
23 0.35
24 0.42
25 0.48
26 0.48
27 0.53
28 0.61
29 0.62
30 0.65
31 0.58
32 0.54
33 0.47
34 0.42
35 0.33
36 0.22
37 0.17
38 0.13
39 0.12
40 0.1
41 0.1
42 0.09
43 0.11
44 0.12
45 0.12
46 0.15
47 0.21
48 0.29
49 0.33
50 0.37
51 0.38
52 0.43
53 0.5
54 0.56
55 0.6
56 0.6
57 0.63
58 0.65
59 0.65
60 0.62
61 0.58
62 0.54
63 0.53
64 0.55
65 0.57
66 0.58
67 0.57
68 0.58
69 0.62
70 0.67
71 0.67
72 0.64
73 0.64
74 0.6
75 0.6
76 0.58
77 0.51
78 0.4
79 0.33
80 0.27
81 0.2
82 0.2
83 0.17
84 0.16
85 0.15
86 0.17
87 0.24
88 0.28
89 0.29
90 0.29
91 0.34
92 0.41
93 0.44
94 0.47
95 0.42
96 0.36
97 0.32
98 0.3
99 0.26
100 0.2
101 0.18
102 0.13
103 0.14
104 0.15
105 0.15
106 0.15
107 0.15
108 0.16
109 0.19
110 0.19
111 0.2
112 0.22
113 0.24
114 0.32
115 0.43
116 0.5
117 0.53
118 0.59
119 0.65
120 0.71
121 0.78
122 0.8
123 0.79
124 0.79
125 0.81
126 0.8
127 0.76
128 0.73
129 0.69
130 0.6
131 0.51
132 0.41