Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SZA4

Protein Details
Accession A0A3M2SZA4    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
17-47LKGSKVTDGRIEKKKKKKPKPKQSEESSASEBasic
102-127KTEAERRYEQQRRKRLQDRLKREGVKBasic
NLS Segment(s)
PositionSequence
14-38KLKLKGSKVTDGRIEKKKKKKPKPK
115-116KR
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPPDDAYSTGGGGKLKLKGSKVTDGRIEKKKKKKPKPKQSEESSASEAVEPKDDTTTTTTDDRKGDTDTDTDVHRSASQREREGTDTGTDTGGDGGTVMVGKTEAERRYEQQRRKRLQDRLKREGVKTHKERVEELNKYLSSLTEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.26
4 0.28
5 0.33
6 0.38
7 0.46
8 0.46
9 0.46
10 0.5
11 0.54
12 0.59
13 0.62
14 0.68
15 0.68
16 0.75
17 0.8
18 0.83
19 0.87
20 0.9
21 0.92
22 0.93
23 0.95
24 0.95
25 0.95
26 0.92
27 0.9
28 0.84
29 0.78
30 0.69
31 0.58
32 0.48
33 0.38
34 0.32
35 0.22
36 0.2
37 0.15
38 0.12
39 0.13
40 0.12
41 0.13
42 0.13
43 0.14
44 0.14
45 0.18
46 0.18
47 0.2
48 0.21
49 0.21
50 0.2
51 0.2
52 0.19
53 0.16
54 0.16
55 0.14
56 0.14
57 0.13
58 0.13
59 0.11
60 0.11
61 0.11
62 0.12
63 0.15
64 0.2
65 0.23
66 0.24
67 0.25
68 0.27
69 0.28
70 0.28
71 0.24
72 0.19
73 0.17
74 0.15
75 0.14
76 0.11
77 0.09
78 0.08
79 0.07
80 0.05
81 0.04
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.05
90 0.1
91 0.12
92 0.16
93 0.18
94 0.22
95 0.32
96 0.41
97 0.49
98 0.53
99 0.63
100 0.67
101 0.74
102 0.8
103 0.8
104 0.82
105 0.84
106 0.84
107 0.82
108 0.84
109 0.79
110 0.72
111 0.71
112 0.69
113 0.69
114 0.66
115 0.66
116 0.61
117 0.58
118 0.59
119 0.59
120 0.6
121 0.54
122 0.5
123 0.49
124 0.45
125 0.44
126 0.41
127 0.32
128 0.26
129 0.23
130 0.24
131 0.21
132 0.22
133 0.24
134 0.29
135 0.28