Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2T0X4

Protein Details
Accession A0A3M2T0X4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKKSSRQPQQPKKKEPLPSTFHydrophilic
NLS Segment(s)
PositionSequence
3-17KRKKSSRQPQQPKKK
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRQPQQPKKKEPLPSTFACLFCNHENSVVIKLDKKLGLGNLSCKVCGQRYQTGINYLSAAVDVYSDWVDACDAVAKDTANRDGGGGPRGARIQEQPGPASVDPYADNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.88
4 0.86
5 0.82
6 0.79
7 0.74
8 0.66
9 0.64
10 0.59
11 0.52
12 0.44
13 0.37
14 0.34
15 0.3
16 0.31
17 0.25
18 0.22
19 0.22
20 0.22
21 0.24
22 0.21
23 0.19
24 0.18
25 0.18
26 0.2
27 0.19
28 0.18
29 0.16
30 0.16
31 0.18
32 0.17
33 0.2
34 0.22
35 0.22
36 0.21
37 0.2
38 0.2
39 0.18
40 0.22
41 0.23
42 0.22
43 0.25
44 0.28
45 0.29
46 0.31
47 0.3
48 0.25
49 0.21
50 0.16
51 0.13
52 0.1
53 0.09
54 0.05
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.04
64 0.05
65 0.07
66 0.07
67 0.08
68 0.09
69 0.09
70 0.1
71 0.13
72 0.15
73 0.13
74 0.13
75 0.13
76 0.14
77 0.16
78 0.17
79 0.16
80 0.15
81 0.16
82 0.17
83 0.17
84 0.18
85 0.19
86 0.24
87 0.27
88 0.3
89 0.29
90 0.29
91 0.34
92 0.32
93 0.31
94 0.24
95 0.21