Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2SYC7

Protein Details
Accession A0A3M2SYC7    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-34PTSTSGKIPGRNRRRCFRRFRPRPAWRSGGHydrophilic
NLS Segment(s)
PositionSequence
11-50KIPGRNRRRCFRRFRPRPAWRSGGGGRRPRRRSAGRRRRG
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences PSVSPTSTSGKIPGRNRRRCFRRFRPRPAWRSGGGGRRPRRRSAGRRRRGWILRAFLVVLPVGIPGSRGLGLRCGWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.74
4 0.79
5 0.82
6 0.83
7 0.85
8 0.85
9 0.86
10 0.85
11 0.89
12 0.89
13 0.9
14 0.88
15 0.84
16 0.77
17 0.67
18 0.63
19 0.57
20 0.54
21 0.52
22 0.54
23 0.55
24 0.6
25 0.62
26 0.59
27 0.62
28 0.63
29 0.67
30 0.69
31 0.73
32 0.73
33 0.77
34 0.78
35 0.79
36 0.75
37 0.71
38 0.67
39 0.61
40 0.53
41 0.47
42 0.43
43 0.34
44 0.29
45 0.22
46 0.15
47 0.09
48 0.07
49 0.06
50 0.05
51 0.06
52 0.05
53 0.07
54 0.09
55 0.1
56 0.1
57 0.15