Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2TBC2

Protein Details
Accession A0A3M2TBC2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-70ETPPDGTQKKRTKQKDGKKHSSNERRPSRTHBasic
NLS Segment(s)
PositionSequence
48-68KKRTKQKDGKKHSSNERRPSR
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MATVSITSDLEPYLASLRSYLADDSRQSPEKDPNEPVAVETPPDGTQKKRTKQKDGKKHSSNERRPSRTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.1
5 0.1
6 0.12
7 0.11
8 0.11
9 0.13
10 0.14
11 0.17
12 0.21
13 0.24
14 0.24
15 0.26
16 0.32
17 0.33
18 0.35
19 0.34
20 0.31
21 0.29
22 0.28
23 0.26
24 0.2
25 0.17
26 0.14
27 0.12
28 0.11
29 0.1
30 0.13
31 0.14
32 0.15
33 0.25
34 0.34
35 0.43
36 0.51
37 0.58
38 0.66
39 0.76
40 0.84
41 0.85
42 0.86
43 0.88
44 0.87
45 0.88
46 0.88
47 0.89
48 0.88
49 0.88
50 0.88