Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2T4K6

Protein Details
Accession A0A3M2T4K6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
193-220VTFKRTQLEDPPKGKKRRKRNEDPPKDTBasic
NLS Segment(s)
PositionSequence
204-214PKGKKRRKRNE
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAPTKPVLHPLKTPKSAVFPSELFNNDSSSTISDTVKHNDDMSTPITPPTAYTEFLKALTPVFNSPVSASMSFPSFPLDRPANSPGPTSQPASALGGSFTFNEPGKSAPATSLPPPTPNSAVGTARMGKTARGLRRLHIPQFSPAAESPRSATTIRSPFSPSDWKDWKVRHLDTPRSASGRPVSVRQVTTRTVTFKRTQLEDPPKGKKRRKRNEDPPKDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.55
4 0.49
5 0.44
6 0.35
7 0.33
8 0.35
9 0.34
10 0.29
11 0.27
12 0.26
13 0.22
14 0.22
15 0.2
16 0.17
17 0.17
18 0.17
19 0.17
20 0.17
21 0.2
22 0.24
23 0.26
24 0.25
25 0.24
26 0.22
27 0.22
28 0.23
29 0.22
30 0.19
31 0.16
32 0.16
33 0.16
34 0.15
35 0.15
36 0.18
37 0.17
38 0.17
39 0.18
40 0.2
41 0.21
42 0.22
43 0.22
44 0.15
45 0.14
46 0.14
47 0.14
48 0.12
49 0.14
50 0.13
51 0.13
52 0.13
53 0.14
54 0.15
55 0.15
56 0.14
57 0.12
58 0.13
59 0.13
60 0.13
61 0.13
62 0.11
63 0.11
64 0.16
65 0.17
66 0.17
67 0.21
68 0.25
69 0.26
70 0.26
71 0.27
72 0.22
73 0.26
74 0.27
75 0.25
76 0.21
77 0.18
78 0.18
79 0.18
80 0.17
81 0.12
82 0.1
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.08
96 0.09
97 0.11
98 0.12
99 0.15
100 0.15
101 0.17
102 0.18
103 0.2
104 0.19
105 0.18
106 0.19
107 0.17
108 0.17
109 0.16
110 0.17
111 0.16
112 0.15
113 0.16
114 0.14
115 0.12
116 0.17
117 0.23
118 0.24
119 0.3
120 0.3
121 0.3
122 0.39
123 0.44
124 0.43
125 0.41
126 0.39
127 0.34
128 0.37
129 0.35
130 0.29
131 0.24
132 0.24
133 0.21
134 0.2
135 0.19
136 0.17
137 0.19
138 0.17
139 0.18
140 0.21
141 0.26
142 0.26
143 0.26
144 0.28
145 0.26
146 0.31
147 0.38
148 0.32
149 0.35
150 0.4
151 0.41
152 0.45
153 0.47
154 0.5
155 0.49
156 0.5
157 0.5
158 0.53
159 0.59
160 0.59
161 0.62
162 0.59
163 0.55
164 0.52
165 0.47
166 0.42
167 0.4
168 0.36
169 0.34
170 0.36
171 0.37
172 0.39
173 0.38
174 0.38
175 0.35
176 0.36
177 0.36
178 0.36
179 0.35
180 0.38
181 0.4
182 0.41
183 0.44
184 0.45
185 0.46
186 0.5
187 0.57
188 0.61
189 0.63
190 0.69
191 0.73
192 0.79
193 0.84
194 0.83
195 0.84
196 0.86
197 0.89
198 0.9
199 0.92
200 0.93