Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9VWU2

Protein Details
Accession A0A4P9VWU2    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
102-128HNHQHPTPTKPPPHRKHPIKAGPTNHPBasic
NLS Segment(s)
PositionSequence
37-51KGERPTSRPPRAKPI
110-122TKPPPHRKHPIKA
Subcellular Location(s) nucl 20.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MTVRHTHSRKNPNTLPTPQHPNTTLPSSNPPISHPPKGERPTSRPPRAKPIQPSPPKNNQPVPRSSPQSHPAPLHQFLPKEAPSKRYKAVPRQPPQPAPPQHNHQHPTPTKPPPHRKHPIKAGPTNHPEAAPSTRPATPPRSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.71
3 0.67
4 0.69
5 0.62
6 0.61
7 0.55
8 0.5
9 0.47
10 0.46
11 0.41
12 0.34
13 0.38
14 0.38
15 0.39
16 0.36
17 0.35
18 0.38
19 0.42
20 0.45
21 0.43
22 0.43
23 0.5
24 0.53
25 0.57
26 0.54
27 0.56
28 0.61
29 0.67
30 0.72
31 0.7
32 0.69
33 0.72
34 0.72
35 0.72
36 0.69
37 0.68
38 0.69
39 0.71
40 0.75
41 0.72
42 0.76
43 0.75
44 0.72
45 0.7
46 0.67
47 0.62
48 0.6
49 0.59
50 0.54
51 0.55
52 0.51
53 0.49
54 0.46
55 0.45
56 0.42
57 0.37
58 0.35
59 0.33
60 0.32
61 0.3
62 0.27
63 0.24
64 0.22
65 0.25
66 0.24
67 0.24
68 0.24
69 0.28
70 0.29
71 0.33
72 0.34
73 0.37
74 0.42
75 0.48
76 0.56
77 0.6
78 0.63
79 0.67
80 0.72
81 0.7
82 0.67
83 0.66
84 0.63
85 0.59
86 0.58
87 0.57
88 0.58
89 0.61
90 0.59
91 0.53
92 0.57
93 0.54
94 0.56
95 0.57
96 0.58
97 0.59
98 0.67
99 0.75
100 0.73
101 0.8
102 0.82
103 0.83
104 0.84
105 0.86
106 0.86
107 0.84
108 0.84
109 0.8
110 0.79
111 0.76
112 0.72
113 0.62
114 0.52
115 0.44
116 0.4
117 0.4
118 0.33
119 0.3
120 0.28
121 0.3
122 0.33
123 0.37