Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WGP8

Protein Details
Accession A0A4P9WGP8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
146-173VPQWSLSPGRRHRPPPTRRDRGLWSRERHydrophilic
NLS Segment(s)
PositionSequence
154-168GRRHRPPPTRRDRGL
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MSNRRSWPPLIDATFRKMSSFTQFPAAPLAFGSPKPKVVLDNVYLNGIHVLHQFELRKVSTYPLTVKLRWGLGSQVGVQLTNELLAGQYRQRGMAASVAARRQQAASLSLASSIESAFSAPGLPRPHPSSTATRLNRALRPPLRLVPQWSLSPGRRHRPPPTRRDRGLWSRERS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.4
4 0.34
5 0.32
6 0.33
7 0.33
8 0.28
9 0.29
10 0.29
11 0.29
12 0.33
13 0.31
14 0.23
15 0.2
16 0.21
17 0.16
18 0.18
19 0.22
20 0.18
21 0.2
22 0.21
23 0.22
24 0.21
25 0.23
26 0.27
27 0.25
28 0.29
29 0.27
30 0.27
31 0.26
32 0.24
33 0.2
34 0.15
35 0.13
36 0.09
37 0.1
38 0.1
39 0.13
40 0.14
41 0.14
42 0.18
43 0.17
44 0.18
45 0.16
46 0.19
47 0.17
48 0.19
49 0.21
50 0.25
51 0.29
52 0.27
53 0.28
54 0.27
55 0.26
56 0.25
57 0.23
58 0.16
59 0.13
60 0.14
61 0.12
62 0.12
63 0.11
64 0.1
65 0.09
66 0.09
67 0.07
68 0.06
69 0.05
70 0.03
71 0.03
72 0.03
73 0.04
74 0.05
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.08
81 0.09
82 0.09
83 0.1
84 0.12
85 0.13
86 0.15
87 0.14
88 0.14
89 0.12
90 0.13
91 0.12
92 0.12
93 0.12
94 0.11
95 0.11
96 0.11
97 0.1
98 0.09
99 0.08
100 0.06
101 0.05
102 0.05
103 0.05
104 0.04
105 0.04
106 0.05
107 0.05
108 0.1
109 0.13
110 0.14
111 0.18
112 0.23
113 0.25
114 0.27
115 0.31
116 0.33
117 0.36
118 0.45
119 0.43
120 0.44
121 0.48
122 0.51
123 0.52
124 0.5
125 0.53
126 0.47
127 0.5
128 0.5
129 0.49
130 0.5
131 0.48
132 0.49
133 0.45
134 0.45
135 0.41
136 0.4
137 0.41
138 0.4
139 0.46
140 0.49
141 0.53
142 0.58
143 0.64
144 0.71
145 0.75
146 0.8
147 0.82
148 0.84
149 0.85
150 0.82
151 0.81
152 0.8
153 0.8
154 0.8