Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W635

Protein Details
Accession A0A4P9W635    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
57-78QDEGGPKRRKGKGKQKQPETAPBasic
NLS Segment(s)
PositionSequence
61-72GPKRRKGKGKQK
Subcellular Location(s) nucl 19, cyto 5, mito 1, plas 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MSLVFRGITTNESFKWEDLAYEINGGSIRISRDLYNINQGLAVTPQDNDADDSRGGQDEGGPKRRKGKGKQKQPETAPTNAAASDDEMEITSIKQLRNVYNRGPLANLMEVLFPAPLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.22
4 0.19
5 0.17
6 0.19
7 0.15
8 0.15
9 0.14
10 0.11
11 0.11
12 0.11
13 0.1
14 0.09
15 0.1
16 0.1
17 0.12
18 0.12
19 0.14
20 0.17
21 0.18
22 0.24
23 0.23
24 0.21
25 0.2
26 0.19
27 0.17
28 0.15
29 0.14
30 0.07
31 0.07
32 0.08
33 0.07
34 0.08
35 0.09
36 0.09
37 0.1
38 0.1
39 0.1
40 0.1
41 0.1
42 0.1
43 0.08
44 0.09
45 0.13
46 0.17
47 0.26
48 0.27
49 0.28
50 0.36
51 0.43
52 0.5
53 0.53
54 0.61
55 0.62
56 0.72
57 0.8
58 0.81
59 0.82
60 0.78
61 0.78
62 0.71
63 0.63
64 0.53
65 0.44
66 0.37
67 0.29
68 0.25
69 0.15
70 0.12
71 0.1
72 0.09
73 0.08
74 0.07
75 0.08
76 0.07
77 0.07
78 0.1
79 0.12
80 0.12
81 0.16
82 0.19
83 0.26
84 0.33
85 0.38
86 0.38
87 0.44
88 0.46
89 0.43
90 0.41
91 0.36
92 0.32
93 0.29
94 0.26
95 0.18
96 0.16
97 0.15
98 0.14