Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W6E7

Protein Details
Accession A0A4P9W6E7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
176-200GDGTRAECRKPVRKNRRGGSRRMYPBasic
NLS Segment(s)
PositionSequence
185-197KPVRKNRRGGSRR
Subcellular Location(s) mito 22.5, cyto_mito 12.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045072  MKRN-like  
IPR018957  Znf_C3HC4_RING-type  
IPR000571  Znf_CCCH  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0000209  P:protein polyubiquitination  
Pfam View protein in Pfam  
PF00097  zf-C3HC4  
PF14608  zf-CCCH_2  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences VCRFFQSPGGCFRGAACRYSHASSRHFLLCSAKKGYCAFGVRCLFSHQLGHTPVAAEEPTELVCGICFDPPPNFGLLIGCDHVFCLTCVRSWRDKQSKTEALRSSNVIKECPVCRAPSPYVVPASVWPHSAAQKSEIVRSYKETVAKIPCKYFIESDPADRTCPFGNDCLYMHDNGDGTRAECRKPVRKNRRGGSRRMYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.28
4 0.27
5 0.32
6 0.35
7 0.4
8 0.35
9 0.37
10 0.38
11 0.41
12 0.4
13 0.36
14 0.34
15 0.37
16 0.37
17 0.39
18 0.42
19 0.38
20 0.37
21 0.38
22 0.39
23 0.35
24 0.35
25 0.31
26 0.34
27 0.37
28 0.34
29 0.34
30 0.36
31 0.32
32 0.27
33 0.29
34 0.21
35 0.23
36 0.24
37 0.24
38 0.2
39 0.19
40 0.18
41 0.16
42 0.15
43 0.09
44 0.08
45 0.08
46 0.07
47 0.07
48 0.07
49 0.05
50 0.05
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.09
57 0.1
58 0.11
59 0.11
60 0.1
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.08
67 0.07
68 0.07
69 0.08
70 0.07
71 0.07
72 0.08
73 0.07
74 0.09
75 0.12
76 0.17
77 0.23
78 0.25
79 0.36
80 0.42
81 0.46
82 0.49
83 0.55
84 0.59
85 0.55
86 0.6
87 0.53
88 0.46
89 0.44
90 0.41
91 0.35
92 0.31
93 0.29
94 0.21
95 0.19
96 0.2
97 0.19
98 0.21
99 0.2
100 0.18
101 0.18
102 0.23
103 0.24
104 0.26
105 0.27
106 0.25
107 0.25
108 0.24
109 0.23
110 0.2
111 0.22
112 0.18
113 0.16
114 0.15
115 0.15
116 0.18
117 0.2
118 0.18
119 0.17
120 0.21
121 0.21
122 0.24
123 0.26
124 0.26
125 0.25
126 0.28
127 0.3
128 0.29
129 0.31
130 0.29
131 0.3
132 0.36
133 0.41
134 0.4
135 0.38
136 0.4
137 0.39
138 0.4
139 0.37
140 0.3
141 0.32
142 0.3
143 0.33
144 0.34
145 0.32
146 0.31
147 0.29
148 0.29
149 0.24
150 0.25
151 0.22
152 0.2
153 0.21
154 0.21
155 0.22
156 0.25
157 0.26
158 0.24
159 0.23
160 0.21
161 0.2
162 0.17
163 0.19
164 0.14
165 0.12
166 0.19
167 0.21
168 0.21
169 0.25
170 0.34
171 0.41
172 0.51
173 0.61
174 0.66
175 0.73
176 0.82
177 0.86
178 0.89
179 0.87
180 0.86