Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9VW72

Protein Details
Accession A0A4P9VW72    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-46QTPKVAPQEKKKKKTGRAKKRILYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
11-38AGKVKGQTPKVAPQEKKKKKTGRAKKRI
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences QGKVHGSLARAGKVKGQTPKVAPQEKKKKKTGRAKKRILYNRRFVNAVATFGKRRVCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.39
4 0.39
5 0.41
6 0.49
7 0.52
8 0.57
9 0.56
10 0.59
11 0.66
12 0.71
13 0.75
14 0.75
15 0.76
16 0.77
17 0.83
18 0.84
19 0.84
20 0.85
21 0.87
22 0.84
23 0.85
24 0.86
25 0.85
26 0.82
27 0.8
28 0.77
29 0.7
30 0.66
31 0.55
32 0.53
33 0.45
34 0.41
35 0.35
36 0.32
37 0.31
38 0.34