Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NED8

Protein Details
Accession B8NED8    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-45ALPMPPRKKHRMSPVERIAEEQARRNTSSPRKKSRLFRCQFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 13.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MSSQALPMPPRKKHRMSPVERIAEEQARRNTSSPRKKSRLFRCQFCARQFQRNEHLQRHERLHTKEKPFGCTVCPQTFTRRPFFAHITTLRYILGSHFRRTFLWSLKDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.77
4 0.8
5 0.8
6 0.79
7 0.72
8 0.66
9 0.59
10 0.55
11 0.49
12 0.46
13 0.42
14 0.38
15 0.39
16 0.38
17 0.42
18 0.47
19 0.55
20 0.57
21 0.62
22 0.66
23 0.71
24 0.79
25 0.81
26 0.82
27 0.78
28 0.75
29 0.73
30 0.75
31 0.74
32 0.68
33 0.67
34 0.59
35 0.61
36 0.57
37 0.55
38 0.52
39 0.53
40 0.55
41 0.49
42 0.53
43 0.48
44 0.5
45 0.49
46 0.48
47 0.46
48 0.46
49 0.5
50 0.51
51 0.52
52 0.54
53 0.52
54 0.51
55 0.47
56 0.43
57 0.37
58 0.35
59 0.36
60 0.33
61 0.34
62 0.31
63 0.38
64 0.45
65 0.46
66 0.46
67 0.42
68 0.41
69 0.43
70 0.46
71 0.4
72 0.39
73 0.38
74 0.37
75 0.36
76 0.34
77 0.29
78 0.25
79 0.22
80 0.18
81 0.25
82 0.24
83 0.29
84 0.31
85 0.33
86 0.34
87 0.39
88 0.42
89 0.4