Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9WDN1

Protein Details
Accession A0A4P9WDN1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
309-337TISPQRLDRTPRSRHQKRGKISGPQAKVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR004136  NMO  
Gene Ontology GO:0018580  F:nitronate monooxygenase activity  
Pfam View protein in Pfam  
PF03060  NMO  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
CDD cd04730  NPD_like  
Amino Acid Sequences MPPRPAFLKQLAMPIIAAPMFLVSGTSLVTAACKQGIVGTFPALNARTPEILDKWLTEIKAALQETPARDAPMTAPFGVNVIVHKTNGRLRKDVEAVIKHQVPIVITSLGAVPEVIEAAIEVGVARRLPPLRPLRMQDQAGADGLIAVCAGAGGHAGVMSPFALVPKLREFYQGPICLAGALSNGASIRAAQVLGADLAYMGTRFIATQESMAEEAYKRMIVDSKNGPAPTYLPVIYTDKISGVNANFLRKSLERAGLDPDNPQGEGLGEEDFSKLGMSLCVVGRDPSCRTTFRFICLYLSFPSHPRPTISPQRLDRTPRSRHQKRGKISGPQAKVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.19
4 0.16
5 0.09
6 0.08
7 0.07
8 0.07
9 0.07
10 0.04
11 0.05
12 0.05
13 0.06
14 0.06
15 0.05
16 0.07
17 0.08
18 0.09
19 0.09
20 0.09
21 0.08
22 0.12
23 0.13
24 0.15
25 0.15
26 0.16
27 0.16
28 0.16
29 0.19
30 0.17
31 0.17
32 0.16
33 0.17
34 0.16
35 0.17
36 0.21
37 0.19
38 0.21
39 0.21
40 0.2
41 0.21
42 0.23
43 0.22
44 0.19
45 0.18
46 0.17
47 0.22
48 0.22
49 0.18
50 0.18
51 0.21
52 0.22
53 0.26
54 0.25
55 0.2
56 0.2
57 0.2
58 0.19
59 0.21
60 0.22
61 0.18
62 0.17
63 0.15
64 0.16
65 0.16
66 0.14
67 0.1
68 0.12
69 0.13
70 0.13
71 0.14
72 0.17
73 0.23
74 0.3
75 0.33
76 0.32
77 0.33
78 0.39
79 0.41
80 0.42
81 0.43
82 0.39
83 0.38
84 0.4
85 0.38
86 0.32
87 0.3
88 0.26
89 0.2
90 0.18
91 0.17
92 0.11
93 0.1
94 0.1
95 0.1
96 0.08
97 0.08
98 0.06
99 0.04
100 0.04
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.05
113 0.08
114 0.09
115 0.1
116 0.19
117 0.26
118 0.31
119 0.35
120 0.38
121 0.4
122 0.45
123 0.45
124 0.39
125 0.34
126 0.29
127 0.25
128 0.22
129 0.16
130 0.1
131 0.09
132 0.06
133 0.04
134 0.03
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.06
153 0.09
154 0.1
155 0.1
156 0.14
157 0.15
158 0.18
159 0.25
160 0.25
161 0.22
162 0.21
163 0.2
164 0.17
165 0.16
166 0.12
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.04
193 0.05
194 0.06
195 0.06
196 0.07
197 0.08
198 0.08
199 0.08
200 0.08
201 0.07
202 0.08
203 0.08
204 0.08
205 0.07
206 0.07
207 0.11
208 0.11
209 0.16
210 0.19
211 0.23
212 0.26
213 0.27
214 0.26
215 0.23
216 0.24
217 0.2
218 0.2
219 0.16
220 0.13
221 0.15
222 0.18
223 0.18
224 0.18
225 0.16
226 0.13
227 0.14
228 0.14
229 0.14
230 0.11
231 0.18
232 0.19
233 0.22
234 0.21
235 0.21
236 0.25
237 0.22
238 0.27
239 0.25
240 0.3
241 0.27
242 0.28
243 0.34
244 0.33
245 0.34
246 0.3
247 0.28
248 0.22
249 0.21
250 0.2
251 0.14
252 0.11
253 0.11
254 0.1
255 0.08
256 0.07
257 0.07
258 0.08
259 0.07
260 0.07
261 0.06
262 0.06
263 0.06
264 0.06
265 0.06
266 0.09
267 0.09
268 0.11
269 0.12
270 0.13
271 0.14
272 0.18
273 0.21
274 0.22
275 0.25
276 0.26
277 0.3
278 0.37
279 0.38
280 0.39
281 0.4
282 0.37
283 0.39
284 0.37
285 0.36
286 0.29
287 0.31
288 0.28
289 0.27
290 0.34
291 0.33
292 0.34
293 0.35
294 0.38
295 0.42
296 0.52
297 0.56
298 0.58
299 0.61
300 0.67
301 0.7
302 0.73
303 0.74
304 0.72
305 0.74
306 0.74
307 0.78
308 0.8
309 0.84
310 0.87
311 0.87
312 0.86
313 0.88
314 0.86
315 0.85
316 0.86
317 0.85