Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W493

Protein Details
Accession A0A4P9W493   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-38SEPVVSFRKTTKPKNVRKRNRSPSPDEDSHHydrophilic
NLS Segment(s)
PositionSequence
20-27KPKNVRKR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MADIPTPGSEPVVSFRKTTKPKNVRKRNRSPSPDEDSHPDSSAAAPTAAAVIPPPKKRVGASTTMTSSGGGLRKKAGAPSSSAPAPPSSAPSHSFDTSGTAKSLSLDMATRTLDVDGAEEGEGPKILAGDDAEGADGLYRGLKGYTEYVNKRSDKVTQSNAGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.35
4 0.43
5 0.51
6 0.57
7 0.61
8 0.71
9 0.8
10 0.88
11 0.89
12 0.92
13 0.94
14 0.94
15 0.94
16 0.91
17 0.89
18 0.86
19 0.83
20 0.76
21 0.68
22 0.64
23 0.57
24 0.51
25 0.44
26 0.35
27 0.27
28 0.23
29 0.21
30 0.16
31 0.11
32 0.08
33 0.07
34 0.08
35 0.07
36 0.06
37 0.05
38 0.1
39 0.16
40 0.19
41 0.21
42 0.22
43 0.24
44 0.25
45 0.3
46 0.29
47 0.3
48 0.31
49 0.32
50 0.31
51 0.3
52 0.3
53 0.24
54 0.2
55 0.16
56 0.17
57 0.14
58 0.13
59 0.13
60 0.14
61 0.15
62 0.17
63 0.16
64 0.13
65 0.16
66 0.17
67 0.19
68 0.18
69 0.18
70 0.16
71 0.14
72 0.15
73 0.12
74 0.13
75 0.12
76 0.13
77 0.16
78 0.18
79 0.22
80 0.21
81 0.21
82 0.18
83 0.2
84 0.2
85 0.18
86 0.15
87 0.12
88 0.11
89 0.12
90 0.12
91 0.08
92 0.07
93 0.07
94 0.07
95 0.08
96 0.09
97 0.08
98 0.08
99 0.08
100 0.08
101 0.07
102 0.07
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.05
124 0.04
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.08
131 0.12
132 0.18
133 0.26
134 0.31
135 0.35
136 0.43
137 0.44
138 0.44
139 0.44
140 0.46
141 0.45
142 0.48
143 0.51
144 0.52