Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W0V6

Protein Details
Accession A0A4P9W0V6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTTCKKDKRPLQPSPKSYPAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, E.R. 6, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTCKKDKRPLQPSPKSYPAVTLTALAPECVLIVMMVAPVGVTDDVEVAMVEAFANGQLMIARTQLLVASAFFPAHFLVRPRLLRAIGRRDPEKVQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.74
4 0.64
5 0.58
6 0.5
7 0.42
8 0.36
9 0.29
10 0.21
11 0.21
12 0.21
13 0.16
14 0.12
15 0.09
16 0.09
17 0.07
18 0.06
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.02
40 0.02
41 0.02
42 0.03
43 0.02
44 0.02
45 0.03
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.05
55 0.05
56 0.06
57 0.07
58 0.07
59 0.06
60 0.07
61 0.07
62 0.08
63 0.1
64 0.11
65 0.16
66 0.23
67 0.25
68 0.28
69 0.31
70 0.33
71 0.38
72 0.43
73 0.48
74 0.48
75 0.53
76 0.53
77 0.53