Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WJE9

Protein Details
Accession A0A4P9WJE9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-40ATAALPPAKPPKRAKKTPPSPPPPALLHydrophilic
NLS Segment(s)
PositionSequence
20-32PAKPPKRAKKTPP
Subcellular Location(s) mito 19, cyto_mito 12.5, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004808  AP_endonuc_1  
IPR020847  AP_endonuclease_F1_BS  
IPR020848  AP_endonuclease_F1_CS  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0003677  F:DNA binding  
GO:0004519  F:endonuclease activity  
GO:0016829  F:lyase activity  
GO:0046872  F:metal ion binding  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
PROSITE View protein in PROSITE  
PS00726  AP_NUCLEASE_F1_1  
PS00727  AP_NUCLEASE_F1_2  
PS00728  AP_NUCLEASE_F1_3  
PS51435  AP_NUCLEASE_F1_4  
CDD cd09087  Ape1-like_AP-endo  
Amino Acid Sequences MPRPKRKQTQTLAATAALPPAKPPKRAKKTPPSPPPPALLAAPDNDLVPVPRFPDKLGSPSDAPANTTFPDKLEFPASPPGTDKIVSWNVAGIAASTKKGFLKYITAEDADIICLQETKLNGEPDDNTWVPLATWPYQYWSHCTAKKGYSGTAVVSKIKPLDVGYGMPEKTGLDFDNEGRLIWLEFETYYLVASYVPNAGNGLVRLTEKMTYNSKLEAYIRKLQEKKPVIWAGDLNVAHKEIDLARPKTNHKTAGFTPEERADFDRILSTKPNFIDSYRHFHPDVVDRYTYYGYRFNCRSKNLGWRLDYFVVSESLLPKIEASEIRSQVYGASDHVPIMLLVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.42
3 0.37
4 0.28
5 0.22
6 0.2
7 0.28
8 0.32
9 0.4
10 0.49
11 0.56
12 0.65
13 0.76
14 0.83
15 0.84
16 0.89
17 0.91
18 0.92
19 0.9
20 0.87
21 0.81
22 0.75
23 0.66
24 0.58
25 0.48
26 0.4
27 0.34
28 0.27
29 0.25
30 0.21
31 0.18
32 0.16
33 0.15
34 0.13
35 0.13
36 0.13
37 0.14
38 0.18
39 0.19
40 0.2
41 0.27
42 0.27
43 0.3
44 0.33
45 0.34
46 0.31
47 0.32
48 0.35
49 0.28
50 0.28
51 0.25
52 0.24
53 0.2
54 0.22
55 0.2
56 0.16
57 0.19
58 0.17
59 0.18
60 0.19
61 0.19
62 0.18
63 0.28
64 0.27
65 0.25
66 0.27
67 0.27
68 0.25
69 0.25
70 0.23
71 0.2
72 0.23
73 0.23
74 0.21
75 0.2
76 0.18
77 0.18
78 0.17
79 0.1
80 0.09
81 0.09
82 0.1
83 0.09
84 0.11
85 0.12
86 0.13
87 0.14
88 0.13
89 0.18
90 0.19
91 0.23
92 0.24
93 0.23
94 0.22
95 0.21
96 0.2
97 0.15
98 0.13
99 0.09
100 0.07
101 0.06
102 0.06
103 0.07
104 0.08
105 0.1
106 0.15
107 0.16
108 0.16
109 0.17
110 0.18
111 0.18
112 0.24
113 0.2
114 0.16
115 0.15
116 0.15
117 0.14
118 0.15
119 0.16
120 0.11
121 0.13
122 0.13
123 0.16
124 0.19
125 0.2
126 0.22
127 0.25
128 0.3
129 0.31
130 0.33
131 0.33
132 0.33
133 0.36
134 0.33
135 0.28
136 0.25
137 0.23
138 0.22
139 0.21
140 0.2
141 0.18
142 0.17
143 0.17
144 0.15
145 0.14
146 0.13
147 0.1
148 0.11
149 0.09
150 0.09
151 0.1
152 0.13
153 0.13
154 0.12
155 0.12
156 0.1
157 0.09
158 0.1
159 0.08
160 0.07
161 0.08
162 0.08
163 0.12
164 0.12
165 0.11
166 0.1
167 0.1
168 0.08
169 0.08
170 0.08
171 0.05
172 0.05
173 0.05
174 0.06
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.07
188 0.08
189 0.07
190 0.06
191 0.06
192 0.07
193 0.08
194 0.09
195 0.1
196 0.13
197 0.17
198 0.18
199 0.19
200 0.2
201 0.2
202 0.19
203 0.21
204 0.24
205 0.26
206 0.31
207 0.33
208 0.39
209 0.43
210 0.45
211 0.52
212 0.51
213 0.48
214 0.49
215 0.5
216 0.44
217 0.41
218 0.38
219 0.3
220 0.31
221 0.29
222 0.21
223 0.18
224 0.18
225 0.15
226 0.15
227 0.14
228 0.09
229 0.16
230 0.23
231 0.25
232 0.28
233 0.32
234 0.38
235 0.45
236 0.49
237 0.49
238 0.43
239 0.46
240 0.44
241 0.5
242 0.49
243 0.42
244 0.4
245 0.37
246 0.37
247 0.33
248 0.33
249 0.27
250 0.23
251 0.22
252 0.23
253 0.19
254 0.21
255 0.24
256 0.23
257 0.25
258 0.26
259 0.29
260 0.25
261 0.26
262 0.33
263 0.31
264 0.38
265 0.36
266 0.4
267 0.36
268 0.36
269 0.39
270 0.39
271 0.4
272 0.36
273 0.34
274 0.31
275 0.33
276 0.35
277 0.32
278 0.26
279 0.27
280 0.24
281 0.31
282 0.36
283 0.41
284 0.46
285 0.49
286 0.51
287 0.51
288 0.59
289 0.6
290 0.62
291 0.58
292 0.55
293 0.58
294 0.55
295 0.5
296 0.4
297 0.33
298 0.26
299 0.23
300 0.21
301 0.15
302 0.14
303 0.14
304 0.13
305 0.12
306 0.12
307 0.15
308 0.16
309 0.2
310 0.27
311 0.28
312 0.3
313 0.3
314 0.29
315 0.26
316 0.26
317 0.22
318 0.16
319 0.16
320 0.15
321 0.15
322 0.15
323 0.14
324 0.12