Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WG06

Protein Details
Accession A0A4P9WG06    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
40-59GDLKKEIKKLQRFRDQIRTWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5cyto_nucl 10.5, nucl 9.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040168  Not2/3/5  
IPR007207  Not_N  
Gene Ontology GO:0030015  C:CCR4-NOT core complex  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF04065  Not3  
Amino Acid Sequences LPAEIEKVLKKVSEGVELFQSIFEKLATATNPAQREKYEGDLKKEIKKLQRFRDQIRTWLASNEIKDKRALEENRRLIEQQMERFKAAEKELKTKAFSKEGLNLPHKIDPLEAEKDAFVHWVNKVKDELIIQMDAFETEQEQLAVRRKGKSVDPSKAVRLGELEKSLERHKWHLTQLEIVLRMFENGKLTLDTVNPIKDDVQNYIDTNQDPDFMDDDAIYDDLELEDAEIFGIAGMDRDDDDGPAEGKTQTAEVIIADADGSGGGLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.3
4 0.3
5 0.3
6 0.25
7 0.23
8 0.15
9 0.14
10 0.12
11 0.09
12 0.09
13 0.12
14 0.12
15 0.16
16 0.2
17 0.25
18 0.3
19 0.32
20 0.34
21 0.3
22 0.35
23 0.33
24 0.36
25 0.4
26 0.41
27 0.45
28 0.51
29 0.55
30 0.57
31 0.61
32 0.6
33 0.6
34 0.65
35 0.68
36 0.69
37 0.76
38 0.75
39 0.76
40 0.8
41 0.73
42 0.7
43 0.67
44 0.6
45 0.51
46 0.45
47 0.42
48 0.35
49 0.35
50 0.37
51 0.33
52 0.31
53 0.32
54 0.31
55 0.3
56 0.36
57 0.4
58 0.39
59 0.47
60 0.52
61 0.52
62 0.53
63 0.5
64 0.42
65 0.43
66 0.39
67 0.36
68 0.38
69 0.38
70 0.37
71 0.37
72 0.37
73 0.33
74 0.31
75 0.3
76 0.25
77 0.3
78 0.34
79 0.36
80 0.37
81 0.38
82 0.39
83 0.36
84 0.36
85 0.31
86 0.34
87 0.36
88 0.4
89 0.39
90 0.37
91 0.36
92 0.36
93 0.34
94 0.27
95 0.22
96 0.17
97 0.19
98 0.19
99 0.17
100 0.15
101 0.14
102 0.14
103 0.14
104 0.13
105 0.09
106 0.08
107 0.09
108 0.16
109 0.17
110 0.18
111 0.18
112 0.18
113 0.18
114 0.17
115 0.17
116 0.11
117 0.11
118 0.09
119 0.09
120 0.09
121 0.07
122 0.07
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.05
129 0.07
130 0.13
131 0.17
132 0.19
133 0.2
134 0.21
135 0.24
136 0.28
137 0.35
138 0.37
139 0.39
140 0.41
141 0.42
142 0.43
143 0.45
144 0.41
145 0.31
146 0.26
147 0.23
148 0.2
149 0.19
150 0.18
151 0.15
152 0.17
153 0.19
154 0.21
155 0.2
156 0.22
157 0.25
158 0.28
159 0.32
160 0.34
161 0.33
162 0.32
163 0.33
164 0.32
165 0.29
166 0.24
167 0.21
168 0.16
169 0.16
170 0.13
171 0.12
172 0.1
173 0.1
174 0.11
175 0.1
176 0.11
177 0.12
178 0.11
179 0.13
180 0.13
181 0.14
182 0.13
183 0.14
184 0.15
185 0.17
186 0.18
187 0.18
188 0.19
189 0.2
190 0.21
191 0.21
192 0.22
193 0.19
194 0.2
195 0.17
196 0.16
197 0.15
198 0.16
199 0.16
200 0.14
201 0.14
202 0.11
203 0.11
204 0.1
205 0.1
206 0.08
207 0.06
208 0.06
209 0.06
210 0.06
211 0.05
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.03
221 0.04
222 0.04
223 0.05
224 0.05
225 0.08
226 0.08
227 0.08
228 0.1
229 0.1
230 0.11
231 0.11
232 0.12
233 0.1
234 0.1
235 0.11
236 0.1
237 0.09
238 0.09
239 0.09
240 0.07
241 0.08
242 0.08
243 0.07
244 0.06
245 0.06
246 0.05
247 0.04
248 0.04