Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9W0V3

Protein Details
Accession A0A4P9W0V3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
146-169TRINPPPRKSAHRRNTPSQMRPVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 5, plas 5, cyto 4, extr 4, pero 3, E.R. 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010929  PDR_CDR_ABC  
Gene Ontology GO:0016020  C:membrane  
GO:0005524  F:ATP binding  
GO:0042626  F:ATPase-coupled transmembrane transporter activity  
Pfam View protein in Pfam  
PF06422  PDR_CDR  
Amino Acid Sequences TGDEFYANYQWDYDNRWRNLGYLACFWVFNIFLAVGLIFKKMQIYFTHTSSSGPVVCFLCDWFLEDGRRSAYDLGGGLGGGGGGKGAFSSEYCEKAREGGNDVRLPRPRTPKDALECPPLLPQHVKLRFSPNPPGITAPPAATTFTRINPPPRKSAHRRNTPSQMRPVCVGAVNSHGLLCCEPVGTWGMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.41
4 0.41
5 0.4
6 0.44
7 0.42
8 0.36
9 0.29
10 0.3
11 0.27
12 0.26
13 0.25
14 0.22
15 0.18
16 0.14
17 0.12
18 0.09
19 0.08
20 0.09
21 0.08
22 0.07
23 0.07
24 0.08
25 0.06
26 0.07
27 0.09
28 0.09
29 0.12
30 0.13
31 0.21
32 0.23
33 0.25
34 0.27
35 0.25
36 0.25
37 0.24
38 0.24
39 0.18
40 0.15
41 0.16
42 0.14
43 0.14
44 0.13
45 0.12
46 0.11
47 0.09
48 0.11
49 0.1
50 0.12
51 0.13
52 0.14
53 0.15
54 0.15
55 0.16
56 0.15
57 0.14
58 0.12
59 0.11
60 0.1
61 0.09
62 0.07
63 0.06
64 0.05
65 0.04
66 0.04
67 0.03
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.03
76 0.07
77 0.08
78 0.12
79 0.13
80 0.14
81 0.14
82 0.16
83 0.18
84 0.15
85 0.19
86 0.19
87 0.22
88 0.24
89 0.26
90 0.29
91 0.31
92 0.34
93 0.35
94 0.42
95 0.41
96 0.44
97 0.47
98 0.49
99 0.5
100 0.53
101 0.51
102 0.47
103 0.44
104 0.39
105 0.38
106 0.31
107 0.28
108 0.22
109 0.23
110 0.27
111 0.31
112 0.33
113 0.31
114 0.4
115 0.43
116 0.46
117 0.5
118 0.45
119 0.42
120 0.41
121 0.42
122 0.35
123 0.32
124 0.29
125 0.21
126 0.18
127 0.17
128 0.18
129 0.14
130 0.18
131 0.17
132 0.18
133 0.23
134 0.25
135 0.34
136 0.42
137 0.45
138 0.49
139 0.53
140 0.61
141 0.65
142 0.73
143 0.73
144 0.75
145 0.79
146 0.81
147 0.85
148 0.85
149 0.82
150 0.82
151 0.76
152 0.68
153 0.62
154 0.55
155 0.46
156 0.38
157 0.33
158 0.24
159 0.22
160 0.21
161 0.19
162 0.18
163 0.16
164 0.15
165 0.14
166 0.14
167 0.11
168 0.09
169 0.09
170 0.1